KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1643Help
Entry
CCDC5079_1643     CDS       T01991                                 

Definition
4-alpha-glucanotransferase malQ
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mte00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1995162..1997345)
Genome map
AA seq 727 aa AA seqDB search
MGDMTELAPSLVELARRFGIATEYTDWTGRQVLVSEATLVAALAALGVPAQTEQQRNDAL
AAQLRSYWARPLPATIVMRAGEQTQFRVHVTDGAPADVWLQLEDGTTRAEVVQVDNFTPP
FDLDGRWIGEASFVLPADLPLGYHRVNLRSGDSQASAAVVVTPDWLGLPDKLAGRRAWGL
AVQLYSVRSRQSWGIGDLTDLANLALWSASAHGAGYVLVNPLHAATLPGPAGRSKPIEPS
PYLPTSRRFVNPLYLRVEAIPELVDLPKRGRVQRLRTNVQQHADQLDTIDRDSAWAAKRA
ALKLVHRVPRSAGRELAYAAFRTREGRALDDFATWCALAETYGDDWHRWPKSLRHPDASG
VADFVDKHADAVDFHRWLQWQLDEQLASAQSQALRAGMSLGIMADLAVGVHPNGADAWAL
QDVLAQGVTAGAPPDEFNQLGQDWSQPPWRPDRLAEQEYRPFRALIQAALRHAGAVRIDH
IIGLFRLWWIPDGAPPTQGTYVRYDHDAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYL
LLRGLLGTSILWFEQDRDCGPAGTPLPAERWREYCLSSVTTHDLPPTAGYLAGDQVRLRE
SLGLLTNPVEAELESARADRAAWMAELRRVGLLADGAEPDSEEAVLALYRYLGRTPSRLL
AVALTDAVGDRRTQNQPGTTDEYPNWRVPLTGPDGQPMLLEDIFTDRRAATLAEAVRAAT
TSPMSCW
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacatgaccgagctcgcgccttcgctggtcgaacttgcccgacgattcggcatt
gccaccgagtacacggactggactggccggcaggtgctggtctccgaggctacattggtg
gctgctcttgccgccctcggcgttcccgcccagaccgaacagcaacgcaatgacgccctg
gccgcgcagctgcgatcctactgggcgcgtccattgccggcgaccatcgtcatgcgcgcc
ggagagcagacgcagttcagggtgcatgtgaccgatggcgctccggccgacgtgtggttg
cagctcgaggacggcacgacacgtgccgaggtggtgcaggtcgacaatttcaccccgcca
ttcgatcttgacggacgctggatcggcgaggccagcttcgtgttgcccgccgacctgccc
ctcggctaccaccgggtgaatctgcgttcgggcgactcgcaggccagcgccgctgttgtc
gtgacgccggattggttggggctgccggacaagctggcaggccgtcgtgcctggggcctg
gccgtccagctctacagcgtgcggtcccggcagtcatggggcatcggggatctcaccgat
ttggcgaatctcgcgctgtggtcggcgtctgcgcacggtgccggctatgtgctggtcaat
cccctgcatgcggctacgcttcccgggcccgctgggcgctcgaagccaatcgaaccatcg
ccctacctgccgacatcgcgacgcttcgtcaaccctctctaccttcgggtggaggccatt
ccggaactcgtcgatctgcccaagcgtggccgggtgcaacggttgcgcaccaacgtgcaa
cagcacgccgaccagctcgacaccattgaccgcgacagcgcctgggcggccaaacgcgca
gcactcaagctcgtgcaccgggtgccgcggtcggcgggtcgcgagctggcctacgccgcc
ttccgtacccgcgagggccgcgccctcgacgacttcgccacctggtgcgcgctggccgag
acgtacggcgatgattggcatcgatggccgaaatcgctgcggcatcccgatgcctcaggt
gtcgccgatttcgtcgacaaacacgccgatgccgtcgatttccaccgctggctgcagtgg
cagctggacgagcagctcgccagtgcgcagtcgcaggcgctccgggccggcatgtcgctg
ggcatcatggcagacctcgccgttggcgtgcaccccaacggggccgacgcctgggctctg
caggacgtgctggcccaaggtgtgaccgcaggtgcgccgccggatgagttcaaccaactc
ggccaggactggtcgcagccaccgtggcggccggaccggctcgctgagcaggagtaccga
ccgtttcgcgcgctgatccaggccgcgttgcggcacgccggtgcggtacgcatcgaccac
atcatcgggctgttccggttgtggtggatccccgacggcgcaccgcccacccaaggcacc
tatgtgcgctacgaccacgacgcgatgatcggcatcgtcgccctggaagcccaccgggcc
ggggcggttgtcgtcggtgaggatctcggcaccgtcgagccgtgggtacgcgactatcta
ctattgcggggcctgctgggcacctcaattctctggtttgagcaggatcgagattgcggg
ccggctggaacaccattgccggccgaacgctggcgggagtactgcttgtcgtcggtgacc
acccatgatctgccgccgaccgccggctacctggccggcgaccaggtacggctgcgcgag
tcccttgggttgttaaccaaccccgtggaggcggaactcgaatccgcccgggccgaccgg
gcagcctggatggccgagctgcgccgggtcggactgctggcggacggtgccgagcccgac
tcggaggaggccgtcctggctctctaccgctacctgggccgaacgccctcgcggctgttg
gcagtggcgttgaccgatgcggtcggcgaccgccggacgcaaaaccagcctggcaccacc
gacgagtacccgaactggcgggtgccgctcaccggccccgacggtcagccgatgctgctc
gaggacatcttcaccgatcgcagggcagccaccttggccgaggcggtgcgcgctgcgacg
acctcaccgatgagctgttggtga

DBGET integrated database retrieval system