KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1694Help
Entry
CCDC5079_1694     CDS       T01991                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCDC5079_1694
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCDC5079_1694
   00630 Glyoxylate and dicarboxylate metabolism
    CCDC5079_1694
Enzymes [BR:mte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CCDC5079_1694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2066329..2068554)
Genome map
AA seq 741 aa AA seqDB search
MTDRVSVGNLRIARVLYDFVNNEALPGTDIDPDSFWAGVDKVVADLTPQNQALLNARDEL
QAQIDKWHRRRVIEPIDMDAYRQFLTEIGYLLPEPDDFTITTSSVDAEITTTAGPQLVVP
VLNARFALNAANARWGSLYDALYGTDVIPETDGAEKGPTYNKVRGDKVIAYARKFLDDSV
PLSSGSFGDATGFTVQDGQLVVALPDKSTGLANPGQFAGYTGAAESPTSVLLINHGLHIE
ILIDPESQVGTTDRAGVKDVILESAITTIMDFEDSVAAVDAADKVLGYRNWLGLNKGDLA
AAVDKDGTAFLRVLNRDRNYTAPGGGQFTLPGRSLMFVRNVGHLMTNDAIVDTDGSEVFE
GIMDALFTGLIAIHGLKASDVNGPLINSRTGSIYIVKPKMHGPAEVAFTCELFSRVEDVL
GLPQNTMKIGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMVRK
GTMKSQPWILAYEDHNVDAGLAAGFSGRAQVGKGMWTMTELMADMVETKIAQPRAGASTA
WVPSPTAATLHALHYHQVDVAAVQQGLAGKRRATIEQLLTIPLAKELAWAPDEIREEVDN
NCQSILGYVVRWVDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITSADVRA
SLERMAPLVDRQNAGDVAYRPMAPNFDDSIAFLAAQELILSGAQQPNGYTEPILHRRRRE
FKARAAEKPAPSDRAGDDAAR
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcgcgtgtcggtgggcaacttgcgcatcgctcgggtgctctacgacttcgtg
aacaatgaagccctgcctggcaccgatatcgacccggacagcttctgggcgggcgtcgac
aaggtcgtcgccgacctgaccccgcagaaccaagctctgttgaacgcccgcgacgagctg
caggcgcagatcgacaagtggcaccggcgtcgggtgatcgagcccatcgacatggatgcc
taccgccagttcctcaccgagatcggctacctgcttcccgaacctgatgacttcaccatc
accacgtccagtgtcgacgctgagatcaccacgaccgccggcccccagctggtggtgccg
gtgctcaacgcgcggtttgctctgaacgcggccaacgctcgctggggctccctctacgac
gccttgtatggcaccgatgtcatccccgagaccgacggcgccgaaaaaggccccacgtac
aacaaggttcgtggcgacaaggtgatcgcgtatgcccgcaagttcctcgacgacagtgtt
ccgctgtcgtcgggttcctttggcgacgccaccggtttcacagtgcaggatggccagctc
gtggttgccttgccggataagtccaccggcctggccaaccccggccagttcgccggctac
accggcgcagccgagtcgccgacatcggtgctgctaatcaatcacggtttgcacatcgag
atcctgatcgatccggagtcgcaggtcggcaccaccgaccgggccggcgtcaaggacgtg
atcctggaatccgcgatcaccacgatcatggacttcgaggactcggtggccgccgtggac
gccgccgacaaggtgctgggttatcggaactggctcggcctgaacaagggcgacctggca
gcagcggtagacaaggacggcaccgctttcctgcgggtgctcaatagggaccggaactac
accgcacccggcggtggccagttcacgctgcctggacgcagcctcatgttcgtccgcaac
gtcggtcacttgatgacgaatgacgccatcgtcgacactgacggcagcgaggtgttcgaa
ggcatcatggatgccctattcaccggcctgatcgccatccacgggctaaaggccagcgac
gtcaacgggccgctgatcaacagccgcaccggctccatctacatcgtcaagccgaagatg
cacggtccggccgaggtggcgtttacctgcgaactgttcagccgggttgaagatgtgctg
gggttgccgcaaaacaccatgaagatcggcatcatggacgaggaacgccggaccacggtc
aacctcaaggcgtgcatcaaagctgccgcggaccgcgtggtgttcatcaacaccgggttc
ctggaccgcaccggcgatgaaatccacacctcgatggaggccggcccgatggtgcgcaag
ggcaccatgaagagccagccgtggatcttggcctacgaagaccacaacgtcgatgccggc
ctggccgccgggttcagcggccgagcccaggtcggcaagggcatgtggacaatgaccgag
ctgatggccgacatggtcgagacaaaaatcgcccagccgcgcgccggggccagcaccgcc
tgggttccctctcccactgcggccaccctgcatgcgctgcactaccaccaggtcgacgtc
gccgcggtgcaacaaggactggcggggaagcgtcgcgccaccatcgaacaattgctgacc
attccgctggccaaggaattggcctgggctcccgacgagatccgcgaagaggtcgacaac
aactgtcaatccatcctcggctacgtggttcgctgggttgatcaaggtgtcggctgctcg
aaggtgcccgacatccacgacgtcgcgctcatggaggaccgggccacgctgcgaatctcc
agccaattgttggccaactggctgcgccacggtgtgatcaccagcgcggatgtgcgggcc
agcttggagcggatggcgccgttggtcgatcgacaaaacgcgggcgacgtggcataccga
ccgatggcacccaacttcgacgacagtatcgccttcctggccgcgcaggagctgatcttg
tccggggcccagcagcccaacggctacaccgagccgatcctgcaccgacgtcgtcgggag
tttaaggcccgggccgctgagaagccggccccatcggacagggccggtgacgatgcggcc
cgctag

DBGET integrated database retrieval system