KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1891Help
Entry
CCDC5079_1891     CDS       T01991                                 

Definition
pyrazinamidase/nicotinamidas PNCA (PZase)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CCDC5079_1891
Enzymes [BR:mte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CCDC5079_1891
    3.5.1.-  
     CCDC5079_1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2281944..2282504)
Genome map
AA seq 186 aa AA seqDB search
MRALIIVDVQNDFCEGGSLAVTGGAALARAISDYLAEAADYHHVVATKDFHIDPGDHFSG
TPDYSSSWPPHCVSGTPGADFHPSLDASAIEAVFYKGAYTGAYSGFEGVDENGTPLLNWL
RQRGVDEVDVVGIATDHCVRQTAEDAVRNGLATRVLVDLTAGVSADTTVAALEEMRTASV
ELVCSS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgttgatcatcgtcgacgtgcagaacgacttctgcgagggtggctcgctggcg
gtaaccggtggcgccgcgctggcccgcgccatcagcgactacctggccgaagcggcggac
taccatcacgtcgtggcaaccaaggacttccacatcgacccgggtgaccacttctccggc
acaccggactattcctcgtcgtggccaccgcattgcgtcagcggtactcccggcgcggac
ttccatcccagtctggacgcgtcggcaatcgaggcggtgttctacaagggtgcctacacc
ggagcgtacagcggcttcgaaggagtcgacgagaacggcacgccactgctgaattggctg
cggcaacgcggcgtcgatgaggtcgatgtggtcggtattgccaccgatcattgtgtgcgc
cagacggccgaggacgcggtacgcaatggcttggccaccagggtgctggtggacctgaca
gcgggtgtgtcggccgataccaccgtcgccgcgctggaggagatgcgcaccgccagcgtc
gagttggtttgcagctcctga

DBGET integrated database retrieval system