KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_2251Help
Entry
CCDC5079_2251     CDS       T01991                                 

Definition
ribokinase rbsK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CCDC5079_2251
Enzymes [BR:mte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CCDC5079_2251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2716448..2717299
Genome map
AA seq 283 aa AA seqDB search
MNMDLTFVVDALPRPGETVLAASLTRTPGGKGANQAVAAARAGAQVQFSGAFGDDPAAAQ
LRAHLRANAVGLDRTVTVPGPSGTAIIVVDASAENTVLVAPGANAHLTPVPSAVANCDVL
LTQLEIPVATALAAARAAQSADAVVMVNASPAGQDRSSLQDLAAIADVVIANEHEANDWP
SPPTHFVITLGVRGARYVGADGVFEVPAPTVTPVDTAGAGDVFAGVLAANWPRNPGSPAE
RLRALRRACAAGALATLVSGAGDCAPAAAAIDAALRANRHNGS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatggacctgacgttcgtggtggacgcgcttccgcgccccggcgagacggtgctt
gcggcgtcgttgacccgaacgccaggcgggaagggcgccaaccaggcggtggccgcagcg
cgcgcaggcgcgcaggtacagttctccggtgcattcggcgacgatccagccgccgcccag
ctgcgggcccacctgcgcgccaacgccgttggactggacaggaccgtcacggtgcccgga
ccgagcgggacggcgattatcgtggtcgatgccagcgccgagaacaccgtgctggtggcg
ccgggtgccaatgcacatctgactccggtaccctcggccgtcgccaactgcgatgtactg
ttgacccagttggagattcctgttgcaaccgcgctggcagccgcgcgggcagcccagtcg
gccgatgcggttgtcatggtcaacgcctccccagccggccaggatcgaagctccttgcag
gacttggccgctatcgccgacgtggtgatcgccaacgagcatgaggcaaacgactggccg
tcgccaccaacacatttcgtgatcaccctgggtgtgcgcggtgcccggtacgtcggcgcg
gacggggtgttcgaggtacccgccccaacggtaacgccagtggataccgccggcgccggc
gacgtatttgccggggtccttgctgcgaattggccgcgcaacccaggttcgccggccgag
cgactgcgcgcattgcggcgggcctgcgctgcgggtgcgctggcaactttggtgtccggt
gccggcgactgcgcaccggccgccgccgcgatcgatgcggccctgcgagccaaccgccac
aacggttcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system