KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_2253Help
Entry
CCDC5079_2253     CDS       T01991                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00330  Arginine and proline metabolism
mte00332  Carbapenem biosynthesis
mte01100  Metabolic pathways
mte01130  Biosynthesis of antibiotics
mte01230  Biosynthesis of amino acids
Module
mte_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CCDC5079_2253
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CCDC5079_2253
Enzymes [BR:mte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CCDC5079_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEJ47443
Position
complement(2720271..2721353)
Genome map
AA seq 360 aa AA seqDB search
MKVGTTALTTPSGMFDAGRLAGLAEAVERRMKAGSDVVIVSSGAIAAGIEPLGLSRRPKD
LATKQAAASVGQVALVNSWSAAFARYGRTVGQVLLTAHDISMRVQHTNAQRTLDRLRALH
AVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALVLLSDIDGLYDCDPRKTADATFI
PEVSGPADLDGVVAGRSSHLGTGGMASKVSAALLAADAGVPVLLAPAADAATALADASVG
TVFAARPARLSARRFWVRYAAEATGALTLDAGAVRAVVRQRRSLLAAGITAVSGRFCGGD
VVELRAPDAAMVARGVVAYDASELATMVGRSTSELPGELRRPVVHADDLVAVSAKQAKQV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcgggaccacggcgcttaccacaccgtccgggatgttcgatgccggccggctg
gccggactggccgaggcggtcgagcggcggatgaaggcgggttccgacgtcgtcatcgtg
tcttcgggcgccatcgccgccggcatcgagccgctcgggctgtcccgtcgtcccaaagat
ctggcgaccaagcaggcggcggccagcgtcgggcaggtcgcgctggtgaactcgtggagc
gcggcgttcgcccgctacggccgcacggtgggccaggtgctgctgaccgcgcacgacatt
tcgatgcgggtgcagcacaccaacgcccaacgcacgctggatcggctgcgcgcgttgcac
gcggtggcgattgtcaacgagaacgacaccgtggccaccaacgagatccggttcggtgac
aacgatcggctgtctgcactggtggcgcacctggtcggcgccgacgctttggtgctgctg
tcggacatcgacggcctctacgactgcgacccgcgcaaaaccgcggacgcgacgttcatt
ccggaggtgtccgggccggcggatctggacggtgtggtcgccggccgcagtagccacctg
ggtactggcggcatggcgtccaaggtgtcggcggcgctgttggccgccgacgccggggtg
ccggtactgctggcccccgcggccgacgccgcgaccgcgctcgccgacgcgtcggtgggc
acggtgtttgcggcccggcccgcgcgtctgtcggcccggcggttctgggtgcgttatgcc
gccgaagcaaccggcgcactgactctcgacgccggtgcggtgcgcgctgtggtgcgacaa
cgccggtcactgctggcggcgggtatcaccgcggtgtccggccggttttgcggcggcgat
gtggtcgaactgcgtgcacccgacgcggccatggtagcccgcggggtggttgcctacgac
gcgtccgagctggccaccatggtgggccggtccacctctgagctacccggcgagctgcgc
cgcccggtggtgcacgccgacgatctggtcgcggtgtcggcgaagcaagctaagcaagtt
tag

DBGET integrated database retrieval system