KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_2460Help
Entry
CCDC5079_2460     CDS       T01991                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCDC5079_2460
Enzymes [BR:mte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CCDC5079_2460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2973129..2974442)
Genome map
AA seq 437 aa AA seqDB search
MTSAYRLRQAVGDDATITLFEPADRLGGVLRTEHIGGQPMDLGAEAFVLRRPEMPALLAE
LGLSDRQLASTGARPLIYSQQRLHPLPPQTVVGIPSSAGSMAGLVDDATLARIDAEAARP
FTWQVGSDPAVADLVADRFGDQVVARSVDPLLSGVYAGSAATIGLRAAAPSVAAALDRGA
TSVTDAVRQALPPGSGGPVFGALDGGYQVLLDGLVRRSRVHWVRARVVQLERGWVLRDET
GGRWQADAVILAVPAPRLARLVDGIAPRTHAAARQIVSASSAVVALAVPGGTAFPHCSGV
LVAGDESPHAKAITLSSRKWGQRGDVALLRLSFGRFGDEPALTASDDQLLAWAADDLVTV
FGVAVDPVDVRVRRWIEAMPQYGPGHADVVAELRAGLPPTLAVAGSYLDGIGVPACVGAA
GRAVTSVIEALDAQVAR
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ttgacctcggcgtaccggctgcggcaggctgtcggcgatgacgcgaccatcaccttgttc
gaaccggccgataggctcggcggggtattgcgcaccgagcatatcggcggacagccaatg
gacctcggcgcggaggcgttcgtgctgcgtaggcccgagatgccggcgcttttggccgag
ctgggcctgtcggaccgccaactcgccagcaccggcgcgcggccgctcatctacagccag
cagcgcttgcacccgctgccgccgcagacggtcgtcgggatcccgtcgtcggcgggctcc
atggcggggctggtcgacgacgcaaccctggcgcggatcgacgccgaagccgctcgtccg
ttcacctggcaggtgggcagcgatcccgcggtggccgacttggtggctgaccggttcggc
gaccaagtcgtggcccggtcggtggacccgctgttaagcggggtatacgcgggctcggcg
gcgacgatcgggctgcgcgcggccgccccgagcgtggccgcggccctggatcgcggggcg
accagtgtgaccgacgcggtccggcaggcgctgccgccgggaagcggcgggccggtgttc
ggcgcgctggacggcgggtatcaggtgctgctcgacgggctcgtccggcgcagccgggtg
cactgggtgcgggccagggtggtccagctcgaacgcggctgggtgctgcgcgacgaaacc
ggcggccgctggcaggccgacgccgtcatcctggcggttccggcgccgcggttggcgcgc
ctcgtcgatggcatcgcgccgcgcacacatgccgccgcccggcagatcgtgagcgcgtcg
tcggcggtggtggcgctggcggtgcccggcggcaccgcgtttccgcactgttccggcgtg
ctggtggccggcgacgagtcaccgcatgccaaggcgatcacattgtcgtcgcgcaaatgg
ggtcagcgcggcgacgtcgcgctgttgcggctgtcgttcggtcggttcggcgacgaaccg
gccctgacggcctccgacgaccaactcctggcctgggcagcggacgacttggtcacggtg
ttcggtgtggccgtcgacccggtcgacgttcgggtccggcgctggatcgaggcgatgccg
cagtacggtcccggccatgccgatgtggtcgccgagctgcgcgccggcctgccaccgacg
ctggccgttgcgggcagctacctcgacgggatcggcgtgccggcctgcgtcggcgcggcg
ggccgggccgtcaccagcgtcatcgaggccttagatgcgcaggtggcacgatag

DBGET integrated database retrieval system