KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_2514Help
Entry
CCDC5079_2514     CDS       T01991                                 

Definition
limonene-1,2-epoxide hydrolase catalytic domain protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_2514
Enzymes [BR:mte01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     CCDC5079_2514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3033923..3034372
Genome map
AA seq 149 aa AA seqDB search
MAELTETSPETPETTEAIRAVEAFLNALQNEDFDTVDAALGDDLVYENVGFSRIRGGRRT
ATLLRRMQGRVGFEVKIHRIGADGAAVLTERTDALIIGPLRVQFWVCGVFEVDDGRITLW
RDYFDVYDMFKGLLRGLVALVVPSLKATL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctgaccgaaacatcgccggaaacccccgaaaccaccgaggccattcgtgcc
gtcgaggcgttcctcaacgccctgcagaacgaagacttcgacaccgtcgacgccgcactg
ggcgacgacctggtctatgagaacgtcgggttttccaggatccgcggtggccgccgcacg
gcaacgctgcttcgccgcatgcagggccgcgtcggcttcgaggtgaagatccaccgcatc
ggcgccgacggcgccgcggtgctcaccgaacgcaccgacgcgctaatcatcggaccgctg
cgggtgcagttctgggtctgcggcgtattcgaggtggacgatgggcggatcaccctgtgg
cgggactacttcgatgtctacgacatgttcaagggcctcttgcgaggcctggtggcgctg
gtggtgccatcgctgaaggcaacgctgtag

DBGET integrated database retrieval system