KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_2631Help
Entry
CCDC5079_2631     CDS       T01991                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase dxr
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mte00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3156215..3157504)
Genome map
AA seq 429 aa AA seqDB search
MIRRRGDNEVVAHNDEVTNSTDGRADGRLRVVVLGSTGSIGTQALQVIADNPDRFEVVGL
AAGGAHLDTLLRQRAQTGVTNIAVADEHAAQRVGDIPYHGSDAATRLVEQTEADVVLNAL
VGALGLRPTLAALKTGARLALANKESLVAGGSLVLRAARPGQIVPVDSEHSALAQCLRGG
TPDEVAKLVLTASGGPFRGWSAADLEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLEVI
ETHLLFGIPYDRIDVVVHPQSIIHSMVTFIDGSTIAQASPPDMKLPISLALGWPRRVSGA
AAACDFHTASSWEFEPLDTDVFPAVELARQAGVAGGCMTAVYNAANEEAAAAFLAGRIGF
PAIVGIIADVLHAADQWAVEPATVDDVLDAQRWARERAQRAVSGMASVAIASTAKPGAAG
RHASTLERS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgatccggcggcgcggtgacaacgaggtggtggcgcacaatgatgaggtgaccaactcg
accgacgggcgcgctgacggccggttgcgggtggtggtgctgggcagtaccggctcgatc
ggcacccaggcgcttcaggtcatcgccgacaatccggaccgtttcgaggtagtcgggctg
gccgctggcggcgcccatctggacacgttgctgcgacaacgtgcgcagaccggggtgacc
aatattgccgtcgctgacgagcacgcggcgcagcgggtcggcgacatcccctaccacgga
tccgacgccgccacccggctggtcgagcagaccgaggccgacgtcgtcctcaatgcgctg
gtcggcgcgttgggcctgcgaccgacgttggccgcgctcaagacgggtgcccggctggcg
ctggccaacaaggaatcgctggtcgccggtggttcgctggtgctgcgggcggcgcggccc
ggtcagatcgtgccggtcgactccgaacactccgcgctggcccagtgcctgcgcggcggc
actcccgacgaggtcgccaagctggtgctgacggcctcgggagggccgtttcggggctgg
tccgcggccgacctcgagcatgtcacccccgagcaggctggcgcgcatcctacgtggtcg
atgggcccgatgaacacgctgaattcggcgtcgctggtcaacaagggacttgaggtcatc
gaaacccacctgctgttcggcatcccctacgaccgcatcgatgtcgtggtgcacccccag
tcgatcatccattcgatggtcaccttcatcgacggttcgacgatcgcccaggccagtccc
ccggacatgaagctaccgatttcgttagcgctgggctggccgcgtcgggtcagcggcgcc
gctgctgcctgtgatttccataccgcgtcgagctgggagttcgagccgttggacaccgac
gtcttccccgcggtcgagttggcccggcaggccggcgtagccggtggctgcatgaccgcg
gtttacaatgcggcgaacgaagaagcagcagcggcgttccttgctggccggatcggcttc
ccggccatcgtcggcatcatcgccgacgtgttgcacgctgccgaccaatgggccgtcgaa
cccgctaccgtggatgacgtactcgacgcgcagcgctgggcccgcgagcgagcgcagcgc
gcggtatctggtatggcttcggtggcgatcgcaagcacggcgaagccgggcgcagcgggt
cgacacgcatcgacgttagaaaggtcctga

DBGET integrated database retrieval system