KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_2765Help
Entry
CCDC5079_2765     CDS       T01991                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCDC5079_2765
   01230 Biosynthesis of amino acids
    CCDC5079_2765
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCDC5079_2765
   00030 Pentose phosphate pathway
    CCDC5079_2765
   00051 Fructose and mannose metabolism
    CCDC5079_2765
   00052 Galactose metabolism
    CCDC5079_2765
  Energy metabolism
   00680 Methane metabolism
    CCDC5079_2765
Enzymes [BR:mte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CCDC5079_2765
Protein phosphatases and associated proteins [BR:mte01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CCDC5079_2765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3343886..3344917)
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCHARYGSSVVGFQNGFRGLLENRRVQLHNDDRNDR
LLAKGGTMLGTARVHPDKLRAGLPQIMQTLDDNGIDVLIPIGGEGTLTAASWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALTVATEAIDRLHSTAESHERVMLVEVMGRHAGWIALN
AGLASGAHMTLIPEQPFDIEEVCRLVKGRFQRGDSHFICVVAEGAKPAPGTIMLREGGLD
EFGHERFTGVAAQLAVEVEKRINKDVRVTVLGHIQRGGTPTAYDRVLATRFGVNAADAAH
AGEYGQMVTLRGQDIGRVPLADAVRKLKLVPQSRYDDAAAFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcggattggagttcttaccggaggcggcgactgtcccggccttaacgccgtcatccgt
gcggtggtgcgtacctgccacgcccgatacggctcgtcggtggtcggatttcagaacggc
tttcgcgggctgctggagaaccgccgtgttcaactgcacaacgacgaccgcaatgaccgg
ctgctggccaagggcggcacgatgctgggcacggcccgggtgcaccccgacaaactgcgg
gcggggctgccccaaatcatgcagaccttggacgacaacgggatcgacgtcctgatcccg
atcggcggtgagggtacgctgaccgccgcgagttggctctccgaagagaatgtgccggtg
gtcggggtgccaaagacgatcgacaacgacatcgactgcaccgatgtgaccttcggccac
gacaccgcgttgaccgtggccaccgaggccatcgaccggctgcacagcaccgccgaatcc
cacgagcgggtgatgctggtggaggtgatgggtaggcatgccggctggatcgcgctgaac
gccgggctggcctccggtgctcacatgaccctgattcctgagcagccgttcgacatcgaa
gaggtgtgccgactggtcaaaggccgtttccagcgcggggactcgcatttcatctgcgtg
gtcgccgaaggcgccaaaccggctccggggacgatcatgctgcgcgagggtggtctcgac
gagttcgggcacgagcgtttcacaggtgtagcggcgcagctggcggtcgaggtcgagaag
cgcatcaacaaggatgtccgggtgacggtgttgggccacatccagcggggtggtactccg
accgcctacgaccgagtgctggccacccgattcggggtgaacgccgccgacgccgcgcat
gcgggcgagtacggccagatggtgacgttgcgcggccaggacatcggtcgggttccgctg
gcggatgcggttcgcaaactcaaactggtgccgcagagccgttacgacgacgccgccgcc
ttcttcggttga

DBGET integrated database retrieval system