KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_3010Help
Entry
CCDC5079_3010     CDS       T01991                                 

Definition
F420 biosynthesis protein fbiB
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    CCDC5079_3010
Enzymes [BR:mte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     CCDC5079_3010
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     CCDC5079_3010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3619986..3621356
Genome map
AA seq 456 aa AA seqDB search
MRPCGSGSLTGPEHGSASTIEILPVIGLPEFRPGDDLSAAVAAAAPWLRDGDVVVVTSKV
VSKCEGRLVPAPEDPEQRDRLRRKLIEDEAVRVLARKDRTLITENRLGLVQAAAGVDGSN
VGRSELALLPVDPDASAATLRAGLRERLGVTVAVVITDTMGRAWRNGQTDAAVGAAGLAV
LRNYAGVRDPYGNELVVTEVAVADEIAAAADLVKGKLTATPVAVVRGFGVSDDGSTARQL
LRPGANDLFWLGTAEALELGRQQAQLLRRSVRRFSTDPVPGDLVEAAVAEALTAPAPHHT
RPTRFVWLQTPAIRARLLDRMKDKWRSDLTSDGLPADAIERRVARGQILYDAPEVVIPML
VPDGAHSYPDAARTDAEHTMFTVAVGAAVQALLVALAVRGLGSCWIGSTIFAADLVRDEL
DLPVDWEPLGAIAIGYADEPSGLRDPVPAADLLILK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaccttgcgggagtggtagcttgaccggccccgaacatggctccgcctcgaccatc
gagatcctgcccgtcatcgggctgcccgaattccgtcccggcgacgatctgagcgccgcc
gtcgccgcggcggcaccgtggctacgcgacggtgacgtcgtggtggttaccagcaaggtg
gtgtccaaatgcgagggccggctggttccggctcccgaagaccccgagcaaagagaccga
ttgcgccgcaagctgatcgaggatgaggcagtgcgcgtgttggcgcgcaaggaccgcacg
ttgatcaccgagaatcgactcgggctggttcaggcggccgccggcgtggacggatccaac
gtcggccggtccgagttagcgctgctgccggtcgatcctgacgccagtgccgcaaccttg
cgcgccgggctgcgcgagcggctcggcgtcaccgtcgccgtggtcatcaccgacaccatg
ggacgcgcctggcgcaacggccagaccgatgccgcagtcggcgctgccggtctggcggtg
ctgcgcaactatgccggtgtccgcgacccatacggcaatgagttggtggtcaccgaggtc
gcagtcgccgacgagatcgccgcggccgccgacttggtcaaaggcaaactgaccgcgacg
ccggtggcggtggtgcgtgggttcggcgtgtccgacgacggctcgacagcccggcaactg
ctgcggccgggcgccaacgacctgttctggctcgggaccgccgaagcgctcgagctgggt
cgccagcaagcccaactgttgcgcaggtccgttcgccggtttagcaccgatccggtgccg
ggcgacctcgtcgaggctgcggtcgccgaggccctcaccgcgccagccccacatcacacc
cggccgacccgattcgtgtggctgcagacaccggccatccgcgcgcggctgctagatcgg
atgaaagacaagtggcggtctgatctcaccagtgacggcttgcccgccgacgcgatagaa
cgccgggtggcacgcggccagatcctctatgacgcacccgaagtcgtcataccgatgctg
gtgcccgacggagcacacagctaccccgatgccgcccgcaccgacgccgagcacaccatg
ttcacggtcgccgtcggagcggccgtacaagccttgctggtcgcgctggccgtgcgcggg
ctgggcagttgctggatcggctcgacgatctttgccgctgacctggtccgcgacgagctg
gacctgccagtcgactgggagccgttgggcgccatcgcgatcggatatgccgacgagccg
tccgggttgcgcgacccggtgcctgccgccgatttgctgatcctgaagtga

DBGET integrated database retrieval system