KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_3063Help
Entry
CCDC5079_3063     CDS       T01991                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CCDC5079_3063
Enzymes [BR:mte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CCDC5079_3063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3680584..3681867)
Genome map
AA seq 427 aa AA seqDB search
MTDFAFDAPTVIRTKRDGGRLSDAAIDWVVKAYTDGRVADEQMSALLMAIVWRGMDRGEI
ARWTAAMLASGARLDFTDLPLATVDKHSTGGVGDKITLPLVPVVAACGGAVPQASGRGLG
HTGGTLDKLESITGFTANLSNQRVREQLCDVGAAIFAAGQLAPADAKLYALRDITGTVES
LPLIASSIMSKKLAEGAGALVLDVKVGSGAFMRSPVQARELAHTMVELGAAHGVPTRALL
TEMNCPLGRTVGNALEVAEALEVLAGGGPPDVVELTLRLAGEMLELAGIHGRDPAQTLRD
GTAMDRFRRLVAAQGGDLSKPLPIGSHSETVTAGASGTMGDIDAMAVGLAAWRLGAGRSR
PGARVQHGAGVRIHRRPGEPVVVGEPLFTLYTNAPERFGAARAELAGGWSIRDSPPQVRP
LIVDRIV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacttcgcattcgacgccccgaccgtcatccgcaccaaacgtgacggcggccgg
ttgtccgacgccgccatcgactgggtcgtcaaggcctataccgacggccgggtcgccgac
gaacagatgtcggcgctgctgatggcgatcgtttggcggggcatggaccgcggcgagatc
gccagatggacggcggccatgctggcctcgggtgcccggctggatttcaccgatctgcca
ctagcgaccgtggacaagcattccaccggcggggtaggtgacaaaatcacgctgccattg
gtgcccgtcgtcgccgcctgcggtggcgcagtgccccaggcgtcgggccgcggactcggc
cacaccggcggcaccctggacaagctggaatccatcaccgggttcaccgcgaatctgtcc
aaccagcgggtgcgcgagcagctttgcgacgtcggcgccgcgatcttcgccgccggccag
ctggcgccagccgatgccaagctgtatgcgctgcgcgacattaccggcaccgtcgaatcg
ctgccgttgatcgccagttcgattatgagcaagaagctggctgagggtgcgggtgcactg
gtgctcgacgtcaaggttggttccggggccttcatgaggtcgccagtgcaggcgcgcgaa
cttgcgcacaccatggtcgaactgggcgcggcgcatggcgtgcccacccgtgccctgctg
acggagatgaactgcccgctgggtcgaaccgtcggcaatgcgctcgaggtggccgaggcg
ctggaggtgctggccggcggcggaccgcccgacgtggtggagctgacgttgcggctggcc
ggcgagatgctcgagcttgccgggatccacggccgggacccggcccagacgctgcgggac
ggcaccgcaatggaccggtttcgccggttggttgccgcgcagggaggtgacttgtcgaaa
ccgttgccgatcggttcgcattcggaaaccgtcacggcgggcgcgagcggcacaatgggc
gacatcgatgcgatggcagtggggttagcggcatggcgactcggtgcgggcaggtcccgc
ccgggcgcacgcgtacagcacggtgcgggggtgcggattcatcgccgcccgggggagccg
gttgtggtcggtgagccgttgttcaccctctacacgaatgctcccgagcgctttggtgcg
gcgcgagccgagctggccggcggttggagtatccgggacagtccgccgcaggtgcggccg
ctaatcgtcgatcggatcgtctga

DBGET integrated database retrieval system