KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_3066Help
Entry
CCDC5079_3066     CDS       T01991                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCDC5079_3066
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCDC5079_3066
   00650 Butanoate metabolism
    CCDC5079_3066
  Energy metabolism
   00190 Oxidative phosphorylation
    CCDC5079_3066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3682822..3683271
Genome map
AA seq 149 aa AA seqDB search
MGALPMSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHLF
IMLMWDNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDATRF
WLNSLLVLSMLFTLMLGTYVIVTFDPNIS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtgggagcacttccgatgagcgccccggtcagacagcgcagccatgaccgtccagccagc
ctggacaacccacgatcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcc
tggctgttcatgcggttttccggtgttgtgttggtgttcctggcgatcgggcacctgttc
atcatgctgatgtgggacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgc
tgggcgtcgccgttctggcagacctgggatctgctgttgttgtggctggcgcagctgcac
ggcggcaacggtctgcgcaccatcattgacgactacagccgcaaagacgccacccgattc
tggctgaactcgttgctggtgttgtccatgctgttcaccctgatgctgggaacctacgtg
atagtgacattcgacccgaacatctcctga

DBGET integrated database retrieval system