KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_3066Help
Entry
CCDC5079_3066     CDS       T01991                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor subunit sdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00020  Citrate cycle (TCA cycle)
mte00190  Oxidative phosphorylation
mte00650  Butanoate metabolism
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01200  Carbon metabolism
Module
mte_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mte_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mte_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCDC5079_3066
   00650 Butanoate metabolism
    CCDC5079_3066
  Energy metabolism
   00190 Oxidative phosphorylation
    CCDC5079_3066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AEJ48256
Position
3682822..3683271
Genome map
AA seq 149 aa AA seqDB search
MGALPMSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHLF
IMLMWDNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDATRF
WLNSLLVLSMLFTLMLGTYVIVTFDPNIS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtgggagcacttccgatgagcgccccggtcagacagcgcagccatgaccgtccagccagc
ctggacaacccacgatcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcc
tggctgttcatgcggttttccggtgttgtgttggtgttcctggcgatcgggcacctgttc
atcatgctgatgtgggacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgc
tgggcgtcgccgttctggcagacctgggatctgctgttgttgtggctggcgcagctgcac
ggcggcaacggtctgcgcaccatcattgacgactacagccgcaaagacgccacccgattc
tggctgaactcgttgctggtgttgtccatgctgttcaccctgatgctgggaacctacgtg
atagtgacattcgacccgaacatctcctga

DBGET integrated database retrieval system