KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_3121Help
Entry
CCDC5079_3121     CDS       T01991                                 

Definition
putative enoyl-CoA hydratase echA18
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mte01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mte00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mte00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:mte00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mte00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mte00310]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:mte00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mte00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mte00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:mte00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation [PATH:mte00281]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mte00362]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:mte00627]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation [PATH:mte00930]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3771723..3772349
Genome map
AA seq 208 aa AA seqDB search
MTKMDEASNPCGGDIEAEMCQLMREQPPAEGVVDRVALQRHRNVALITLSHPQAQNALNL
ASWRRLKRLLDDLAGESGLRAVVLRGAGDKAFAAGADIKEFPNTRMSAADAAEYNESLAV
CLRALTTMPIPVIAAVRGLAVGGGCELATACDVCIATDDARFGIPLGKLGVTTGFTEADT
VARLIGPAALKYLLFSGELIGIEEAARW
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagatggacgaggctagcaatccgtgcggcggggacatcgaagctgagatgtgc
cagttgatgcgcgagcaaccacccgccgaaggcgtcgtcgatcgtgtcgcgctgcaacgc
catcgaaacgttgcgttgatcacgctgagccatccgcaggcgcagaacgcactcaacctg
gcgagctggcgtcggctgaagcggctgctggacgatctcgccggcgaatcggggctgcgg
gcggtggtgctgcggggcgccggtgacaaggcgttcgccgcgggtgccgacatcaaggag
tttccgaacacccgcatgagcgccgcggacgccgcggagtacaacgagagcctggccgtc
tgcctgagggcgttgaccacgatgccgatcccagtcatcgcggcggtccgggggctcgcc
gtcggtggcggctgtgagctggcgacggcctgcgatgtgtgcatcgcgaccgacgacgcg
cgcttcggcatcccgctgggcaagctcggcgtcacgacgggcttcaccgaggcggacacc
gtcgcgcgcctcatcggtccggcggcgctgaagtatctgttgttcagcggagaactgatc
ggcattgaggaagccgcccgctggtga

DBGET integrated database retrieval system