KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_3208Help
Entry
CCDC5079_3208     CDS       T01991                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CCDC5079_3208
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CCDC5079_3208
Enzymes [BR:mte01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CCDC5079_3208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3870890..3871498
Genome map
AA seq 202 aa AA seqDB search
MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRG
LHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSDGLAHG
FLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDV
RASGLLPRWEQTQRFIGEMRGT
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacgcgaactcgacgtccccggcgcctgggagattaccccgaccatccatgtc
gattcccgcggactgttcttcgaatggcttaccgatcatgggttccgcgcattcgcaggt
cacagtttggacgtccggcaagtgaactgctcggtgtcatcggccggtgtgctgcgcggc
ctgcactttgcccagttgccgccgagccaggccaagtatgtgacctgcgtttccggctcg
gtgttcgatgtcgtcgtcgacatccgagagggctcaccgacattcggccgatgggactcg
gtgctgctcgacgaccaagaccgtaggacgatctacgtctccgacggcctagcgcacggc
ttccttgcactgcaagacaattcgacggtgatgtacttgtgctcggcggaatacaatccg
cagcgcgagcacaccatctgcgccacagatccgacgttggcggtcgattggccgctggtc
gatggcgctgcccccagcctgtccgaccgtgatgccgctgcgcccagcttcgaggatgtg
cgcgcgtctggcctgctgcccaggtgggaacagacgcagcggttcattggggagatgcgc
ggcacctag

DBGET integrated database retrieval system