KEGG   Mycobacterium tuberculosis F11: TBFG_10061Help
Entry
TBFG_10061        CDS       T00545                                 

Definition
cellulase celA1
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mtf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
65656..66798
Genome map
AA seq 380 aa AA seqDB search
MTRRTGQRWRGTLPGRRPWTRPAPATCRRHLAFVELRHYFARVMSSAIGSVARWIVPLLG
VAAVASIGVIADPVRVVRAPALILVDAANPLAGKPFYVDPASAAMVAARNANPPNAELTS
VANTPQSYWLDQAFPPATVGGTVARYTGAAQAAGAMPVLTLYGIPHRDCGSYASGGFATG
TDYRGWIDAVASGLGSSPATIIVEPDALAMADCLSPDQRQERFDLVRYAVDTLTRDPAAA
VYVDAGHSRWLSAEAMAARLNDVGVGRARGFSLNVSNFYTTDEEIGYGEAISGLTNGSHY
VIDTSRNGAGPAPDAPLNWCNPSGRALGAPPTTATAGAHADAYLWIKRPGESDGTCGRGE
PQAGRFVSQYAIDLAHNAGQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtcggactgggcagcgatggcgcgggactctgcccgggcgccggccttggaca
cggccagcgcccgccacctgtcgtcggcatttggcgtttgtcgaattgcggcattatttt
gctcgggtgatgtcatcagctattggttcggtcgcgcggtggatagtccccctcctgggg
gttgcagccgttgcttccatcggtgttatcgcggacccggtgcgggtcgttcgggccccg
gcgttgatcctggtcgatgcggcaaacccgctggccggaaagcccttctacgtcgatccc
gcctcggcggccatggtcgccgcgcgcaacgccaacccgccgaacgccgagctgacctcc
gtcgccaacaccccgcagtcctactggctcgaccaggcattcccgccggcgaccgtcggc
ggcacggttgccaggtacaccggagcggcgcaggcggccggcgccatgccggttctgacg
ctgtatggaatcccccatcgcgactgcggtagctacgcatccggtgggttcgcgacgggc
actgattaccgcgggtggatcgacgctgtcgcatccggcctgggctcatcgccggcgacg
atcatcgtcgaacccgatgcgctggccatggccgactgcctgtcgcctgaccagcgccag
gaacgtttcgacttggtgcgctacgccgtcgacacgctgacccgcgacccggccgctgcc
gtgtacgtcgatgcggggcattcgcgctggctgagcgccgaggcaatggccgccaggctc
aacgatgtcggtgtgggccgcgcgcgcgggtttagcctcaacgtctcgaacttctacacc
accgatgaggaaatcggctatggcgaggcgatttcggggctcacgaacggttcgcattac
gtgatcgacacgtcgcgcaacggcgccggacccgcgcccgacgccccgctcaactggtgt
aaccccagcggccgcgccctgggcgcaccgcccaccacggcgaccgcgggcgcgcacgcc
gacgcttacctgtggatcaaacgtcccggggaatcggacggaacctgcggtcgcggggag
cctcaggcgggtcggttcgttagccagtacgccatcgatctggcccacaacgccggccag
tag

DBGET integrated database retrieval system