KEGG   Mycobacterium tuberculosis F11: TBFG_10240Help
Entry
TBFG_10240        CDS       T00545                                 

Definition
lipoprotein lpqI
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TBFG_10240
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TBFG_10240
Enzymes [BR:mtf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TBFG_10240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287504..288670
Genome map
AA seq 388 aa AA seqDB search
MAFPRTLAILAAAAALVVACSHGGTPTGSSTTSGASPATPVAVPVPRSCAEPAGIPALLS
PRDKLAQLLVVGVRDAADAQAVVTNYHVGGILIGSDTDLTIFDGALAEIVAGGGPLPLAV
SVDEEGGRVSRLRSLIGGTGPSARELAQTRTVQQVRDLARDRGRQMRKLGITIDFAPVVD
VTDAPDDTVIGDRSFGSDPATVTAYAGAYAQGLRDAGVLPVLKHFPGHGRGSGDSHNGGA
TTPPLDDLVGDDLVPYRTLVTQAPVGVMVGHLQVPGLTGSEPASLSKAAVNLLRTGTGYG
APPFDGPVFSDDLSGMAAISDRFGVSEAVLRTLQAGADIALWVTTKEVPAVLDRLEQALR
AGELPMSAVDRSVVRVATMKGPNPGCGR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcttttccacgcacactggcgatactcgctgcggcagcagcgttggtggtggcctgc
agccatggcggcacacccaccggatcgtcgacgacctccggcgcgtcgcccgcaactccg
gtagccgttcccgtgccccggagctgcgccgagccggcggggatcccggcgctgctgtcc
ccccgtgacaagctggcccagctgctggtggtcggcgtgcgagatgctgcggacgcccaa
gccgtggtcaccaactaccacgtcggcggcatcctcatcggcagcgacaccgacctgacg
atttttgacggcgcgctggccgagatcgttgccggcgggggtccgctgccgctggcggtg
agtgtcgacgaggaaggcgggcgggtgtcccggttgaggtcgctgatcggcggtacgggg
ccgtcggcccgcgaactggcacaaacccgaaccgtccagcaggtgcgcgacttggctcga
gaccgcggccggcagatgagaaagctgggtatcaccatcgacttcgccccggtggtcgac
gtcaccgacgccccggatgacacggtgatcggggaccggtcgttcggctcggatccggct
acggtcaccgcgtatgccggggcgtacgcgcagggtctgcgcgatgccggggtgctgccg
gtgctcaagcatttccccggtcacgggcgtggctcgggtgattcgcacaacgggggtgcc
acgacaccaccgcttgatgacctggtgggcgatgacctggtgccctaccgaacgctggtg
acccaggcgccggtcggtgtgatggtgggtcatctgcaggttcctgggttgaccggctcc
gagccggccagtctgagcaaggccgcggtgaacctgctgcgcaccggcacgggatacggc
gcaccgccgttcgatggtccagtgttcagcgacgacctctctggtatggccgcgatctca
gaccggtttggcgtcagcgaggcggtgttgcgcaccttgcaagccggtgccgatatcgca
ctgtgggttaccaccaaagaggtgcccgcggtgctggaccgcctggaacaggcgctgcgc
gccggtgaattgccgatgtcggcggtcgaccggtcggtggtgcgggtggcgaccatgaag
gggcccaacccggggtgtggccgttag

DBGET integrated database retrieval system