KEGG   Mycobacterium tuberculosis F11: TBFG_10246Help
Entry
TBFG_10246        CDS       T00545                                 

Definition
(GenBank) acetyl-CoA acyltransferase fadA2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
mtf00071  Fatty acid degradation
mtf00072  Synthesis and degradation of ketone bodies
mtf00280  Valine, leucine and isoleucine degradation
mtf00310  Lysine degradation
mtf00362  Benzoate degradation
mtf00380  Tryptophan metabolism
mtf00620  Pyruvate metabolism
mtf00630  Glyoxylate and dicarboxylate metabolism
mtf00640  Propanoate metabolism
mtf00650  Butanoate metabolism
mtf00900  Terpenoid backbone biosynthesis
mtf01100  Metabolic pathways
mtf01110  Biosynthesis of secondary metabolites
mtf01120  Microbial metabolism in diverse environments
mtf01130  Biosynthesis of antibiotics
mtf01200  Carbon metabolism
mtf01212  Fatty acid metabolism
mtf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TBFG_10246
   00630 Glyoxylate and dicarboxylate metabolism
    TBFG_10246
   00640 Propanoate metabolism
    TBFG_10246
   00650 Butanoate metabolism
    TBFG_10246
  Lipid metabolism
   00071 Fatty acid degradation
    TBFG_10246
   00072 Synthesis and degradation of ketone bodies
    TBFG_10246
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBFG_10246
   00310 Lysine degradation
    TBFG_10246
   00380 Tryptophan metabolism
    TBFG_10246
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TBFG_10246
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBFG_10246
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TBFG_10246
Enzymes [BR:mtf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TBFG_10246
Exosome [BR:mtf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TBFG_10246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABR04589
Position
292489..293811
Genome map
AA seq 440 aa AA seqDB search
MAPAAKNTSQTRRRVAVLGGNRIPFARSDGAYADASNQDMFTAALSGLVDRFGLAGERLD
MVVGGAVLKHSRDFNLMRECVLGSELSPYTPAFDLQQACGTGLQAAIAAADGIAAGRYEV
AAAGGVDTTSDPPIGLGDDLRRTLLKLRRSRSNVQRLKLVGTLPASLGVEIPANSEPRTG
LSMGEHAAVTAKQMGIKRVDQDELAAASHRNMADAYDRGFFDDLVSPFLGLYRDDNLRPN
SSVEKLATLRPVFGVKAGDATMTAGNSTPLTDGASVALLASEQWAEAHSLAPLAYLVDAE
TAAVDYVNGNDGLLMAPTYAVPRLLARNGLSLQDFDFYEIHEAFASVVLAHLAAWESEEY
CKRRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRILAQTAKQLAEKKAAKKGGGPL
RGLISICAAGGQGVAAILEA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtggcccctgctgctaagaacacttcacagaccaggcggcgagtcgccgtactgggcggc
aaccgcatcccgttcgccagatcggacggtgcctacgcggatgcgtccaaccaggacatg
ttcaccgcggcgctgagcggcttggtggaccgattcggactcgccggcgagcggctggac
atggtggtgggcggtgcggtgctcaaacacagccgcgacttcaatctaatgcgcgaatgc
gtgctgggctccgaactctcgccgtacacgccggcgttcgacctgcagcaggcctgcggg
acgggcctgcaggccgcgatcgcggccgccgacggcattgccgccgggcggtatgaggtg
gccgccgctggcggggtggacaccacctcggacccgccgatcggcctgggcgacgacctg
cgccgcaccctgctcaagctgcgccgatctaggtccaacgtgcaacgcctcaagctggtg
ggcacgctgccggccagcctgggcgtggagatccccgccaacagcgagccgcgcaccggg
ctgtcgatgggcgagcacgccgccgtcaccgccaagcagatgggcatcaaacgcgtagac
caggacgagctggccgccgccagccatcgcaatatggccgacgcctacgaccggggtttc
ttcgacgacctggtcagtccgtttttagggctgtaccgagacgacaatctgcggcctaac
tccagcgtcgagaaactggccacgctgcgtccggtcttcggagtgaaggccggtgacgcg
acgatgacggccggcaattcgactccgctgaccgacggcgcctcggtggcattgctggcc
agcgaacagtgggcggaggcacactcgctggctccgctggcctatctcgtggatgccgag
accgccgcggtcgactatgtcaacggcaacgacggcctgttgatggcgccgacctacgcg
gtaccccggctgctggcccgtaacgggttgagcctgcaggacttcgacttctacgaaatc
cacgaggcgtttgcctccgtggtgctcgcgcatctggcggcgtgggagtccgaggagtac
tgcaagcggcggctgggcctggacgccgcgctggggtcgatcgatcggtccaagctcaac
gtcaacgggtcgtcgttggccgccgggcaccccttcgcggcgaccggtgggcggattttg
gcgcagaccgccaagcagctcgccgagaagaaggcggcgaaaaaaggcggcggaccgctg
cgcgggctgatttcgatctgcgcggccggcggccaaggtgtggccgcgattttggaggcc
tga

DBGET integrated database retrieval system