KEGG   Mycobacterium tuberculosis F11: TBFG_10583Help
Entry
TBFG_10583        CDS       T00545                                 

Definition
nicotinate phosphoribosyltransferase (EC:2.4.2.11)
Orthology
K00763  
nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mtf00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(669079..670470)
Genome map
AA seq 463 aa AA seqDB search
MAIRQHVGALFTDLYEVTMAQAYWAERMSGTAVFEIFFRKLPPGRSYIMAAGLADVVEFL
EAFRFDEQDLRYLRGLGQFSDEFLRWLAGVRFTGDVWAAPEGTVIFPNEPAVQLIAPIIE
AQLVETFVLNQIHLQSVLASKAARVVAAARGRPVVDFGARRAHGTDAACKVARTSYLAGA
AGTSNLLAARQYGIPTFGTMAHSFVQAFDSEVAAFEAFARLYPATMLLVDTYDTLRGVDH
VIELAKRLGNRFDVRAVRLDSGDLDELSKATRARLDTAGLEQVEIFASSGLDENRIAALL
AARCPIDGFGVGTQLVVAQDAPALDMAYKLVAYDGSGRTKFSSGKVIYPGRKQVFRKLEH
GVFCGDTLGEHGENLPGDPLLVPIMTNGRRIRQHAPTLDGARDWARQQIDALPPELRSLE
DTGYSYPVAVSDRIVGELARLRHADTAEAHPGSNVVGAKAKRP
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcgatccgccaacacgtcggcgcgctgttcaccgacctgtacgaggtgacgatggcc
caggcctactgggccgaaagaatgtcgggcacagcggttttcgagatattcttccgcaag
cttccgcctggcaggtcctacatcatggccgccgggctggccgatgtggtcgagttcctc
gaagcgtttcgattcgacgagcaggatctgcgttacctgcgtggcctgggccagttttcc
gacgagttcctgaggtggctggccggagtgcgtttcaccggagatgtctgggccgcgccg
gaaggaaccgtgatttttccgaacgaacccgcggtccagctgatcgcgccaatcatcgag
gcccagcttgtcgagacgtttgtgctgaaccagattcatctgcaaagcgtgctcgcgagc
aaggccgcgcgggtggtcgccgccgcgcgcggacgaccggtggtggatttcggcgcgcgg
cgcgctcacggcaccgacgcggcctgcaaggtcgcgcgcaccagttatctcgcgggcgct
gcgggcacgtcgaatctgctcgcggcccgccaatatgggatcccgacgttcggcaccatg
gcgcacagctttgttcaagccttcgacagtgaggtggccgcgttcgaggcgttcgcccgg
ctctacccagccaccatgctgctcgtggacacctacgacacgctacgcggcgtcgatcac
gtcatcgagttggccaagcggctgggcaatcgcttcgatgtgcgcgcggtccggctggat
tccggcgacctcgatgagctgtccaaggcgacccgtgcacggctcgacaccgccggtctc
gagcaggtcgagatcttcgcgtcgtcgggcctcgacgaaaaccgcatcgccgcgcttttg
gctgcccgctgtccgatcgacggcttcggcgtgggcacccagctcgtcgtggctcaagac
gcgcccgcgctggacatggcctacaagctggtggcatacgacggcagcgggcgcaccaag
ttctccagcggcaaggtgatctacccgggacgcaagcaggtgttccgtaagctcgagcac
ggagtcttttgcggcgacacgctcggcgagcacggtgaaaaccttcccggggacccgttg
ctggtgcccatcatgaccaacggccgacgcatccggcagcatgcacccacattggacggc
gcgcgggactgggcccgccagcagatcgacgcgctcccgccggagctgcgctcgctcgag
gacaccggctactcgtatccggtggcggtcagcgacaggatcgtgggcgaactcgcccgg
ctgcggcacgccgacacggccgaagcccaccccgggtccaacgtcgtcggggcgaaggcc
aaacgaccctag

DBGET integrated database retrieval system