KEGG   Mycobacterium tuberculosis F11: TBFG_10818Help
Entry
TBFG_10818        CDS       T00545                                 

Definition
(GenBank) phosphoribosylformylglycinamidine synthase II purL
  KO
K01952  phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
mtf00230  Purine metabolism
mtf01100  Metabolic pathways
mtf01110  Biosynthesis of secondary metabolites
mtf01130  Biosynthesis of antibiotics
Module
mtf_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mtf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TBFG_10818
Enzymes [BR:mtf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     TBFG_10818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ABR05161
Position
898331..900595
Genome map
AA seq 754 aa AA seqDB search
MLDTVEHAATTPDQPQPYGELGLKDDEYRRIRQILGRRPTDTELAMYSVMWSEHCSYKSS
KVHLRYFGETTSDEMRAAMLAGIGENAGVVDIGDGWAVTFKVESHNHPSYVEPYQGAATG
VGGIVRDIMAMGARPVAVMDQLRFGAADAPDTRRVLDGVVRGIGGYGNSLGLPNIGGETV
FDPCYAGNPLVNALCVGVLRQEDLHLAFASGAGNKIILFGARTGLDGIGGVSVLASDTFD
AEGSRKKLPSVQVGDPFMEKVLIECCLELYAGGLVIGIQDLGGAGLSCATSELASAGDGG
MTIQLDSVPLRAKEMTPAEVLCSESQERMCAVVSPKNVDAFLAVCRKWEVLATVIGEVTD
GDRLQITWHGETVVDVPPRTVAHEGPVYQRPVARPDTQDALNADRSAKLSRPVTGDELRA
TLLALLGSPHLCSRAFITEQYDRYVRGNTVLAEHADGGMLRIDESTGRGIAVSTDASGRY
TLLDPYAGAQLALAEAYRNVAVTGATPVAVTNCLNFGSPEDPGVMWQFTQAVRGLADGCA
DLGIPVTGGNVSFYNQTGSAAILPTPVVGVLGVIDDVRRRIPTGLGAEPGETLMLLGDTR
DEFDGSVWAQVTADHLGGLPPVVDLAREKLLAAVLSSASRDGLVSAAHDLSEGGLAQAIV
ESALAGETGCRIVLPEGADPFVLLFSESAGRVLVAVPRTEESRFRGMCEARGLPAVRIGV
VDQGSDAVEVQGLFAVSLAELRATSEAVLPRYFG
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
gtgctggacaccgtcgaacacgccgcgaccacacccgaccaaccacaaccgtatggtgag
ctgggcctcaaagacgacgagtaccggcggattcgccagatcctgggccgccggcccacc
gacaccgagctggccatgtactcggtgatgtggagcgaacactgttcgtacaagtcctcc
aaggtgcacctgcgctacttcggtgagaccacctccgacgagatgcgcgcggccatgctg
gccggcatcggcgagaacgccggcgtcgtcgacatcggcgacggctgggcggtcaccttc
aaggtggagtcacacaaccacccgtcctacgtcgagccctaccagggcgcggccaccggg
gtgggcggcatcgtccgcgacatcatggccatgggcgcccgaccggtcgccgtgatggac
cagcttcggttcggcgccgccgacgcccccgatacccgccgcgtgctcgacggcgtggtc
cgcggcatcggcggatacggcaactccctgggcctgcccaacattggcggagagaccgtc
ttcgacccgtgctacgccggcaaccccttagtgaacgcgttgtgtgtcggcgtattacgg
caggaggacctgcatttggcgttcgcctccggcgccggcaacaagatcatcctgtttggc
gcgcgcaccgggctcgacggtatcggcggggtgtcggtgctggcgtcggacaccttcgat
gccgagggatcccgcaagaagctgccctcggtgcaggtcggcgacccgttcatggagaag
gtgctcatcgaatgctgtctcgagctctacgcgggcggcctggtgatcggcatccaagac
ctgggcggagccggattatcttgtgccacatcggagttagcatccgccggtgatggcgga
atgacgatccagctggacagcgtcccgctgcgggccaaggagatgacgcccgccgaggtg
ctctgcagcgaatcgcaggagcggatgtgcgcggtggtctccccgaagaacgtcgacgca
ttcctggcggtgtgccgcaagtgggaggtgctggcgacggtgatcggcgaggtcaccgac
ggcgaccggctgcagatcacctggcacggcgagacggtggtcgacgtgccgccgcgcacc
gtagctcacgaaggtccggtatatcagcgcccggtcgcccgccccgatacgcaggacgcg
ctgaacgccgaccgctcggccaagctgtcacggccggtcaccggcgacgagctgcgcgcg
actttgcttgcgttacttggcagcccgcacctgtgcagccgcgcgttcatcaccgagcag
tacgaccgctatgtgcgcggcaacacggtgctcgccgagcacgccgacggcggcatgctg
cgcatcgacgagtcgaccggccggggcatcgcggtatcgaccgacgcgtcgggacgctac
acgctgctggatccctacgctggcgcgcaactcgcgttggccgaggcgtaccgcaacgtc
gccgtcaccggcgccaccccggtcgcggtgaccaactgcctgaacttcggttcccccgag
gaccccggcgtgatgtggcagttcacgcaggcggtccgcggtctggccgatggctgtgcg
gacctcgggattccggtgaccggtggcaacgtgagtttctacaaccaaaccggttcggcg
gcaatcctgcccacgccggtggtcggggtgctcggcgtcatcgacgatgtgcgtcggcgc
atccctaccggcctgggcgccgagcccggggaaacgttgatgctgttgggcgacacccgc
gacgagttcgacggttccgtgtgggcgcaggtgaccgcagaccacctgggtggattgccg
ccggtagtcgatctggcgcgggagaagctgctggccgcggtgctgagctcggcgtcgcgg
gacgggctagtgtccgcggcgcacgatctgtccgagggtgggctggcccaagccatcgtg
gaatcggcgttagcgggtgaaaccggttgccgcatagtgcttcccgaaggggctgacccg
tttgtgctgctgttctccgagtcggcgggtcgggtgctggtcgcggtgccacgcaccgag
gagagccggtttcgcgggatgtgtgaggcgcggggacttcccgcggtccgcatcggcgtc
gtcgatcaaggttcggacgcggttgaggtgcagggcttgttcgcggtgtcgttggccgaa
ctgcgtgcgacatccgaggcggtgttgccgcgatacttcggatga

DBGET integrated database retrieval system