KEGG   Mycobacterium tuberculosis F11: TBFG_10961Help
Entry
TBFG_10961        CDS       T00545                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mtf03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057567..1058067
Genome map
AA seq 166 aa AA seqDB search
MSSSAGVLVAGTPQPRALGPDALDVSTDDLAGLLAGNTGRIKTVITDQKVIAGIGNAYSD
EILHVAKISPFATAGKLSGAQLTCLHEAMASVLSDAVRRSVGQGAAMLKGEKRSGLRVHA
RTGLPCPVCGDTVREVSFADKSFQYCPTCQTGGKALADRRMSRLLK
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ttgtcatcgtcggcaggggtgctggtggccgggacgccgcagccgcgcgcgctcgggccc
gatgcgctggacgtcagcaccgacgacctggccgggctgttggccggcaacaccggccgg
atcaagaccgtcatcaccgaccagaaggtaattgccggcatcggcaacgcctatagtgac
gaaatcctgcacgtcgcgaagatctcgccgttcgccacggccggcaagttatccggcgca
cagctcacctgcctgcatgaggcgatggcgtcggtgctgtcggacgcggtgcgccggtcc
gtcggccagggcgcggccatgctcaaaggggagaaacgttctgggcttcgagtacatgcg
cgcaccgggttaccctgcccagtgtgcggtgacaccgtgcgggaggtgtccttcgcggac
aagtcttttcagtactgtccaacgtgtcagaccggtggcaaggcgctggccgaccggcgt
atgtcgcggctgctcaagtag

DBGET integrated database retrieval system