KEGG   Mycobacterium tuberculosis F11: TBFG_11322Help
Entry
TBFG_11322        CDS       T00545                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TBFG_11322
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TBFG_11322
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TBFG_11322
Enzymes [BR:mtf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TBFG_11322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1454464..1455546
Genome map
AA seq 360 aa AA seqDB search
MTVPPTATHQPWPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAATNLSKQTGCTIHLKVE
GLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEI
VDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQLGLIDKLPRMLGTQAAGAAPLVLGEPV
SHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPASA
ASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALKDMPSVSPVPVDPVAVVEKLGLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccgccgacggccactcaccagccgtggccgggagtgattgccgcgtaccgt
gaccggctgccggtgggtgacgactggactccggtgaccctgctcgagggtggtactccc
ctcatcgcggcaactaatctctccaagcagacgggctgcacgatccacctcaaagtggag
ggcctcaaccccaccggctccttcaaggatcgtggcatgacgatggcggtcaccgatgcc
cttgcccatggtcagcgggcggtcttgtgcgcatcgaccggaaatacctcggcgtcggcg
gcggcctatgccgcccgggccggcatcacctgcgcggtgctgataccgcagggcaagatc
gcgatgggcaagctcgcacaggcggtcatgcacggcgccaagatcatccagatcgacggt
aacttcgacgactgcctggaactggcgcgcaagatggccgcggacttcccgacgatttcg
ttggtcaactcggtaaacccggtgcgcatcgagggccagaaaacggcagcgttcgagatc
gtcgacgtgctaggtaccgcgccggacgtgcatgctctgccggttggcaacgccggcaac
atcaccgcgtactggaagggctacaccgagtatcaccagctgggcctgatcgacaagttg
ccccgcatgctgggcactcaggccgcgggcgcggcgcccctggtgctcggcgaaccggtg
agccacccggagaccatcgcaaccgcgatccgcatcggctcgccggcgtcgtggacttcg
gccgtcgaggcacagcagcagtccaagggccgcttcttggccgcctccgacgaggagata
ctggctgcatatcacctggtggctcgtgtcgaaggcgtattcgtggagcccgcgtccgca
gccagcattgcgggtctcctcaaagcgatcgacgacggctgggtggcgcgtggttcgacg
gtggtgtgcacggtaaccggcaacggtcttaaggatcccgacaccgcgctcaaagacatg
ccgagcgtgtctccggttcccgtggacccggtagccgtcgtcgagaagctagggctggcc
tag

DBGET integrated database retrieval system