KEGG   Mycobacterium tuberculosis F11: TBFG_11418Help
Entry
TBFG_11418        CDS       T00545                                 

Definition
(GenBank) guanylate kinase gmk
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
mtf00230  Purine metabolism
mtf01100  Metabolic pathways
Module
mtf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mtf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TBFG_11418
Enzymes [BR:mtf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TBFG_11418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 CPT RsgA_GTPase MMR_HSR1 AAA_33 AAA_29 AAA_22 ABC_tran Rad17
Motif
Other DBs
NCBI-ProteinID: ABR05761
Structure
PDB: 

Jmol
Position
1568715..1569368
Genome map
AA seq 217 aa AA seqDB search
MGGTRPGAPVSVGEGPDTKPTARGQPAAVGRVVVLSGPSAVGKSTVVRCLRERIPNLHFS
VSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAA
TGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTAR
IELAAQGDFDKVVVNRRLESACAELVSLLVGTAPGSP
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtggggggaacccgcccaggagcgccagtgagcgtcggcgagggaccggacaccaagccc
accgcgcgtggccaaccggcggcagtgggacgtgtggtggtgctgtccggtccttccgcg
gtcggcaaatccacggtggttcggtgtctgcgcgagcggatcccgaatctgcatttcagt
gtctcggccacgacgcgggcgccacgcccgggcgaggtcgacggtgtcgactaccacttc
atcgaccccacccgctttcagcagctcatcgaccagggtgagttgctggaatgggcagaa
atccacggcggcctgcaccggtcgggcactttggcccagccggtgcgggcggccgcggcg
actggtgtgccggtgcttatcgaggttgacctggccggggccagggcgatcaagaagacg
atgcccgaggctgtcaccgtgtttctggcgccacctagctggcaggatcttcaggccaga
ctgattggccgcggcaccgaaacagctgacgttatccaacgccgcctggacaccgcgcgg
atcgaattggcagcgcagggcgactttgacaaggtcgtggtgaacaggcgattagagtct
gcgtgtgcggaattggtatccttgctggtgggaacggcaccgggctccccgtga

DBGET integrated database retrieval system