KEGG   Mycobacterium tuberculosis F11: TBFG_11466Help
Entry
TBFG_11466        CDS       T00545                                 

Definition
(GenBank) triosephosphate isomerase tpi
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
mtf00010  Glycolysis / Gluconeogenesis
mtf00051  Fructose and mannose metabolism
mtf00562  Inositol phosphate metabolism
mtf01100  Metabolic pathways
mtf01110  Biosynthesis of secondary metabolites
mtf01120  Microbial metabolism in diverse environments
mtf01130  Biosynthesis of antibiotics
mtf01200  Carbon metabolism
mtf01230  Biosynthesis of amino acids
Module
mtf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtf_M00002  Glycolysis, core module involving three-carbon compounds
mtf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBFG_11466
   00051 Fructose and mannose metabolism
    TBFG_11466
   00562 Inositol phosphate metabolism
    TBFG_11466
Enzymes [BR:mtf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TBFG_11466
Exosome [BR:mtf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TBFG_11466
  Exosomal proteins of bladder cancer cells
   TBFG_11466
  Exosomal proteins of melanoma cells
   TBFG_11466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABR05809
Structure
PDB: 

Jmol
Position
1619926..1620711
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGD
KLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAAT
ALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTG
RVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGG
ASLDGEHFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccgctgatagccggcaactggaagatgaacctcaaccactacgaggcg
atcgcgctggtgcaaaagatcgcgttctcgttgccggacaagtattacgaccgggttgac
gtcgcggtgatcccgccgtttaccgacctgcgcagcgtgcaaaccctggtcgacggcgac
aagctgcggttgacctatggtgcacaagacttgtcaccacatgactccggtgcctatacg
ggtgacgtcagcggcgcctttctggccaagttggggtgcagttacgttgtcgtcgggcac
tccgagcggcgcacctatcacaacgaggatgacgcgctggtggccgccaaagccgccacc
gcactcaagcatggcttgaccccaatcgtgtgtattggcgagcacctcgacgtccgcgag
gcgggaaatcatgtggcccacaacatcgaacagttgcgtggatcgctggccgggctattg
gccgagcagatcggcagcgtcgtcatcgcctacgaaccggtctgggcgatcggcaccggg
cgggtggccagcgccgccgacgcccaggaggtgtgtgcggcgatccgaaaagagttggcc
tcgttggcctcgccgaggattgccgatacggtgcgggtgctctacggcggctcggtgaac
gccaaaaacgtcggcgacatcgtggcccaggatgacgtcgatggtggcctggtcggcggg
gcgtcgctggacggggagcatttcgcgacgctggccgcgattgcggccggtggtccgttg
ccgtag

DBGET integrated database retrieval system