KEGG   Mycobacterium tuberculosis F11: TBFG_11504Help
Entry
TBFG_11504        CDS       T00545                                 

Definition
aconitate hydratase (EC:4.2.1.3)
Orthology
K01681  
aconitate hydratase [EC:4.2.1.3]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TBFG_11504
   01210 2-Oxocarboxylic acid metabolism
    TBFG_11504
   01230 Biosynthesis of amino acids
    TBFG_11504
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TBFG_11504
   00630 Glyoxylate and dicarboxylate metabolism
    TBFG_11504
Enzymes [BR:mtf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     TBFG_11504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1667852..1670683)
Genome map
AA seq 943 aa AA seqDB search
MTSKSVNSFGAHDTLKVGEKSYQIYRLDAVPNTAKLPYSLKVLAENLLRNEDGSNITKDH
IEAIANWDPKAEPSIEIQYTPARVVMQDFTGVPCIVDLATMREAIADLGGNPDKVNPLAP
ADLVIDHSVIADLFGRADAFERNVEIEYQRNGERYQFLRWGQGAFDDFKVVPPGTGIVHQ
VNIEYLASVVMTRDGVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLI
PRVVGFRLTGEIQPGVTATDVVLTVTEMLRQHGVVGKFVEFYGEGVAEVPLANRATLGNM
SPEFGSTAAIFPIDEETIKYLRFTGRTPEQVALVEAYAKAQGMWHDPKHEPEFSEYLELN
LSDVVPSIAGPKRPQDRIALAQAKSTFREQIYHYVGNGSPDSPHDPHSKLDEVVEETFPA
SDPGQLTFANDDVATDETVHSAAAHADGRVSNPVRVKSDELGEFVLDHGAVVIAAITSCT
NTSNPEVMLGAALLARNAVEKGLTSKPWVKTTIAPGSQVVNDYYDRSGLWPYLEKLGFYL
VGYGCTTCIGNSGPLPEEISKAVNDNDLSVTAVLSGNRNFEGRINPDVKMNYLASPPLVI
AYALAGTMDFDFQTQPLGQDKDGKNVFLRDIWPSQQDVSDTIAAAINQEMFTRNYADVFK
GDDRWRNLPTPSGNTFEWDPNSTYVRKPPYFEGMTAKPEPVGNISGARVLALLGDSVTTD
HISPAGAIKPGTPAARYLDEHGVDRKDYNSFGSRRGNHEVMIRGTFANIRLRNQLLDDVS
GGYTRDFTQPGGPQAFIYDAAQNYAAQHIPLVVFGGKEYGSGSSRDWAAKGTLLLGVRAV
IAESFERIHRSNLIGMGVIPLQFPEGKSASSLGLDGTEVFDITGIDVLNDGKTPKTVCVQ
ATKGDGATIEFDAVVRIDTPGEADYYRNGGILQYVLRNILKSG
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
gtgactagcaaatctgtgaactcattcggagcgcacgacaccctgaaggtcggcgaaaag
agttaccagatctatcgtctcgacgccgtccccaataccgcgaaactcccctacagcctc
aaagtgctcgccgagaacctgttgcgcaacgaggacggcagcaacatcaccaaggaccac
atcgaggccatcgccaactgggaccctaaggccgagcccagcatcgagatccagtacacg
cccgcccgggtggtgatgcaggacttcaccggcgtaccgtgcatcgtcgacttggccacc
atgcgcgaggcgatcgccgatctgggcggcaacccggacaaggtcaacccgctggcgccc
gcagacttggtgatcgaccactcggtgatcgccgatttgttcggccgcgccgacgcattc
gagcgcaacgtcgaaatcgaataccagcgcaacggtgagcgttaccaattcctgcgctgg
ggccaaggcgctttcgacgacttcaaagtggtgccgccgggcaccggcatcgtgcaccag
gtcaatatcgagtacctggccagcgtggtgatgactcgcgacggagtggcctaccccgac
acctgcgtgggcaccgactcacacaccaccatggtcaacggcctgggtgtgctcgggtgg
ggtgtcggcggcatcgaggcggaggccgcgatgctgggtcagccggtatcgatgctgatc
ccgcgggtcgtgggtttcaggttgaccggcgagatccagccgggagtcaccgccaccgac
gtggtgttgaccgtcaccgagatgctgcgccagcacggcgtcgtcggcaaattcgtcgag
ttctacggcgagggcgtggccgaggtgccgctggccaaccgcgccaccctgggcaacatg
agtcccgaattcggttccaccgcagcgattttcccgatcgacgaagaaaccatcaagtat
ctgcggtttaccggtcgcacgccggagcaggtcgcactggtcgaggcctacgccaaggcg
cagggcatgtggcacgatcccaagcacgagccggagttctcggaatacctcgaactcaac
ctatccgacgtggtgccgtcgatcgccggaccaaagcgtccacaggaccgaatcgcgttg
gcgcaagccaaatcaacattccgcgagcagatttaccactatgtcggcaatggttccccg
gattccccccacgacccgcactcgaagctggacgaggtagtcgaggagacattcccggcc
agcgacccggggcagctgacgttcgccaacgacgacgtcgccactgacgaaaccgtgcac
tcggctgccgcgcatgccgatggccgggtgagcaacccagtgcgggtgaagtcggacgaa
ctcggcgaattcgtgctcgaccacggcgcggtggtgattgccgcgatcacgtcctgcacc
aacacctccaaccccgaagtaatgctgggcgcggcgctgctggcccgcaacgccgtcgaa
aagggactgacctcgaagccgtgggtgaagaccacgattgccccgggctcgcaagtggtc
aacgactactacgacagatccggcctgtggccgtatctggagaagctcggcttctatctg
gtcggctacggctgcaccacctgcatcggcaactccgggccgctgcccgaggaaatctca
aaagcggttaacgacaacgacctttcggtgaccgcggtactgtccggcaaccggaacttc
gagggccgtatcaacccagacgtgaagatgaactacctggcatcgccgccgctggtcatc
gcctacgcgctggccgggaccatggacttcgacttccaaacccagccgctcggtcaagac
aaagacggtaagaacgtttttctccgcgatatctggccatcgcagcaggatgtctccgac
accatcgccgcggcgatcaaccaggagatgttcacccgcaactacgccgacgtgttcaag
ggcgacgaccgctggcgcaacctgccaaccccgagcggcaacacctttgagtgggacccg
aattcgacctacgtgcgcaagccgccgtatttcgaggggatgacagccaaacccgaaccg
gtcggcaacatcagcggtgcccgggtgctggcgctgctcggtgattcggtgaccaccgac
cacatctcccccgccggcgccatcaagcccggaactcccgcggcgcgctacctcgacgaa
cacggtgtcgaccgcaaggactacaactccttcggttctcgccgcggcaaccacgaggtg
atgattcgtggcaccttcgccaacatccggctgcgtaaccaactgctagacgacgtgtcc
ggcggttatacccgcgacttcacccagccgggcggtccgcaggcgttcatctacgacgcc
gcgcagaactatgcggcgcaacacattccgctggttgtgttcggcggcaaagagtacggg
tcgggttcgtcacgggactgggcggccaaaggcacattgctactgggcgtgcgggcggtg
atcgccgagtcattcgagcggatccaccggtccaacctgatcggcatgggcgtgatcccg
ctgcagttccccgaaggaaagtcagcgtcgtcgttgggactcgacggtaccgaggtcttc
gacatcaccggtatcgacgtgcttaacgacggcaagacacccaagacggtgtgcgtccag
gccaccaagggcgacggcgccacgatcgagttcgacgccgtggtgcgcatcgacaccccc
ggtgaggcggactactaccgcaacggcggcatcctgcagtacgtgctgcgcaacatactg
aagtcaggctga

DBGET integrated database retrieval system