KEGG   Mycobacterium tuberculosis F11: TBFG_11627Help
Entry
TBFG_11627        CDS       T00545                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TBFG_11627 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TBFG_11627 (trpC)
Enzymes [BR:mtf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TBFG_11627 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1805601..1806449
Genome map
AA seq 282 aa AA seqDB search
MGDSGKGTAGMSPATVLDSILEGVRADVAAREASVSLSEIKAAAAAAPPPLDVMAALREP
GIGVIAEVKRASPSAGALATIADPAKLAQAYQDGGARIVSVVTEQRRFQGSLDDLDAVRA
SVSIPVLRKDFVVQPYQIHEARAHGADMLLLIVAALEQSVLVSMLDRTESLGMTALVEVH
TEREADRALKAGAKVIGVNARDLMTLDVDRDCFARIAPGLPSSVIRIAESGVRGTADLLA
YAGAGADAVLVGEGLVTSGDPRAAVADLVTAGTHPSCPKPAR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgacagtgggaagggaacggcaggcatgagtccggcaaccgtgctcgactccatc
ctcgagggagtccgggccgacgttgccgcgcgtgaagcctcggtgagcctgtcggagatc
aaggctgccgccgctgcggcgccgccgccgctcgacgtgatggccgccctacgcgagccc
ggcatcggcgtcatcgctgaggtcaagcgcgctagtccttcggcaggcgcattggcgacc
atcgccgacccggcaaagctggcccaggcctaccaggatggcggtgcccggatcgtcagc
gtggtgactgagcagcggcgttttcagggatcgctcgacgacctcgacgcggtgcgggcc
tcggtttcgattccggtgctgcgcaaggactttgtggtgcagccgtaccagattcatgag
gcgcgtgcgcacggcgccgacatgttgttgctcatcgtcgccgcattggagcagtcggtg
ttggtgtcgatgttggaccgcaccgaatcgttgggtatgacagcactcgtcgaggtccat
accgagcgggaagccgaccgagcgctgaaggccggggccaaggtgattggcgttaacgcc
cgcgacctcatgacgctggacgtggaccgggattgcttcgcgcgaatagctcctggtttg
ccgagcagtgtgatcaggattgctgaatccggcgtgcgtggcaccgctgacctgctggcg
tacgccggcgcgggcgctgacgcggtgttggtaggcgaaggtctggtcaccagcggcgac
ccacgtgccgcggttgccgatctggttaccgcgggcacccatccgtcctgtccgaaaccg
gctcgctag

DBGET integrated database retrieval system