KEGG   Mycobacterium tuberculosis F11: TBFG_11934Help
Entry
TBFG_11934        CDS       T00545                                 

Definition
D-amino acid oxidase aao
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mtf00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mtf00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:mtf00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:mtf00311]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2159694..2160656)
Genome map
AA seq 320 aa AA seqDB search
MAIGEQQVIVIGAGVSGLTSAICLAEAGWPVRVWAAALPQQTTSAVAGAVWGPRPKEPVA
KVRGWIEQSLHVFRDLAKDPATGVRMTPALSVGDRIETGAMPPGLELIPDVRPADPADVP
GGFRAGFHATLPMIDMPQYLDCLTQRLAATGCEIETRPLRSLAEAAEAAPIVINCAGLGA
RELAGDATVWPRFGQHVVLTNPGLEQLFIERTGGSEWICYFAHPQRVVCGGISIPGRWDP
TPEPEITERILQRCRRIQPRLAEAAVIETITGLRPDRPSVRVEAEPIGRALCIHNYGHGG
DGVTLSWGCAREVVNLVGGG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtggcaataggtgagcaacaggtcatcgtgattggggccggcgtcagcggactgacgtcg
gccatatgcctggccgaggcggggtggccggtgcgggtatgggcggccgcattgccgcag
caaacgacatcggcggtggcgggtgcggtctgggggccgcggccgaaggaacccgttgcc
aaggtacgcgggtggatcgaacagtcattgcacgtgtttcgcgacttggccaaggatccc
gccaccggcgtgcgcatgacgccggcgctgagtgtcggcgatcgtatcgagaccggtgcg
atgccgcccgggttggagctgatccccgacgtgcggccggctgacccggccgacgtgccc
gggggcttccgtgctgggtttcatgccaccttgccgatgatcgatatgccccagtacctc
gactgtctgacccagcgattggcggcgactggctgtgaaatcgaaacgcgcccgctacgg
tcgctggccgaggccgctgaggcggcgcccatagtgatcaactgtgctggtctgggcgct
cgggaactggccggcgacgccacggtctggccgcggttcggccagcacgtcgtcctcacc
aatccaggtctagagcaactgtttatcgagcgcaccggcggctcggaatggatctgctac
tttgcccacccgcagcgtgtagtctgcggcggcatcagtatccctggcaggtgggacccc
accccagagccggagataaccgagcggatcctgcaacggtgtcgccgcatacaaccacgg
cttgccgaggcggcagtgattgagacgattaccgggctgcgtcctgatcggccgtccgtg
cgggtggaagctgaaccgatcgggcgagcgctgtgcatccacaactatggccacggaggt
gacggcgtgaccctgtcatggggttgtgcgcgggaggtggtcaatcttgtcggcggcggt
taa

DBGET integrated database retrieval system