KEGG   Mycobacterium tuberculosis F11: TBFG_12463Help
Entry
TBFG_12463        CDS       T00545                                 

Definition
ribokinase rbsK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mtf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TBFG_12463
Enzymes [BR:mtf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TBFG_12463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2747904..2748818
Genome map
AA seq 304 aa AA seqDB search
MANASETNVGPMAPRVCVVGSVNMDLTFVVDALPRPGETVLAASLTRTPGGKGANQAVAA
ARAGAQVQFSGAFGDDPAAAQLRAHLRANAVGLDRTVTVPGPSGTAIIVVDASAENTVLV
APGANAHLTPVPSAVANCDVLLTQLEIPVATALAAARAAQSADAVVMVNASPAGQDRSSL
QDLAAIADVVIANEHEANDWPSPPTHFVITLGVRGARYVGADGVFEVPAPTVTPVDTAGA
GDVFAGVLAANWPRNPGSPAERLRALRRACAAGALATLVSGAGDCAPAAAAIDAALRANR
HNGS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgccagtgagactaacgtcggccccatggcgccccgggtgtgcgtggtaggc
agcgtgaacatggacctgacgttcgtggtggacgcgcttccgcgccccggcgagacggtg
cttgcggcgtcgttgacccgaacgccaggcgggaagggcgccaaccaggcggtggccgca
gcgcgcgcaggcgcgcaggtacagttctccggtgcattcggcgacgatccagccgccgcc
cagctgcgggcccacctgcgcgccaacgccgttggactggacaggaccgtcacggtgccc
ggaccgagcgggacggcgattatcgtggtcgatgccagcgccgagaacaccgtgctggtg
gcgccgggtgccaatgcacatctgactccggtaccctcggccgtcgccaactgcgatgta
ctgttgacccagttggagattcctgttgcaaccgcgctggcagccgcgcgggcagcccag
tcggccgatgcggttgtcatggtcaacgcctccccagccggccaggatcgaagctccttg
caggacttggccgctatcgccgacgtggtgatcgccaacgagcatgaggcaaacgactgg
ccgtcgccaccaacacatttcgtgatcaccctgggtgtgcgcggtgcccggtacgtcggc
gcggacggggtgttcgaggtacccgccccaacggtaacgccagtggataccgccggcgcc
ggcgacgtatttgccggggtccttgctgcgaattggccgcgcaacccaggttcgccggcc
gagcgactgcgcgcattgcggcgggcctgcgctgcgggtgcgctggcaactttggtgtcc
ggtgccggcgactgcgcaccggccgccgccgcgatcgatgcggccctgcgagccaaccgc
cacaacggttcatga

DBGET integrated database retrieval system