KEGG   Mycobacterium tuberculosis F11: TBFG_12982Help
Entry
TBFG_12982        CDS       T00545                                 

Definition
pyruvate carboxylase (EC:6.4.1.1)
Orthology
K01958  
pyruvate carboxylase [EC:6.4.1.1]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mtf01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtf01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mtf00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mtf00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3331136..3334519)
Genome map
AA seq 1127 aa AA seqDB search
MFSKVLVANRGEIAIRAFRAAYELGVGTVAVYPYEDRNSQHRLKADESYQIGDIGHPVHA
YLSVDEIVATARRAGADAIYPGYGFLSENPDLAAACAAAGISFVGPSAEVLELAGNKSRA
IAAAREAGLPVLMSSAPSASVDELLSVAAGMPFPLFVKAVAGGGGRGMRRVGDIAALPEA
IEAASREAESAFGDPTVYLEQAVINPRHIEVQILADNLGDVIHLYERDCSVQRRHQKVIE
LAPAPHLDAELRYKMCVDAVAFARHIGYSCAGTVEFLLDERGEYVFIEMNPRVQVEHTVT
EEITDVDLVASQLRIAAGETLEQLGLRQEDIAPHGAALQCRITTEDPANGFRPDTGRISA
LRTAGGAGVRLDGSTNLGAEISPYFDSMLVKLTCRGRDLPTAVSRARRAIAEFRIRGVST
NIPFLQAVLDDPDFRAGRVTTSFIDERPQLLTARASADRGTKILNFLADVTVNNPYGSRP
STIYPDDKLPDLDLRAAPPAGSKQRLVKLGPEGFARWLRESAAVGVTDTTFRDAHQSLLA
TRVRTSGLSRVAPYLARTMPQLLSVECWGGATYDVALRFLKEDPWERLATLRAAMPNICL
QMLLRGRNTVGYTPYPEIVTSAFVQEATATGIDIFRIFDALNNIESMRPAIDAVRETGSA
IAEVAMCYTGDLTDPGEQLYTLDYYLKLAEQIVDAGAHVLAIKDMAGLLRPPAAQRLVSA
LRSRFDLPVHLHTHDTPGGQLASYVAAWHAGADAVDGAAAPLAGTTSQPALSSIVAAAAH
TEYDTGLSLSAVCALEPYWEALRKVYAPFESGLPGPTGRVYHHEIPGGQLSNLRQQAIAL
GLGDRFEEIEEAYAGADRVLGRLVKVTPTSKVVGDLALALVGAGVSADEFASDPARFGIP
ESVLGFLRGELGDPPGGWPEPLRTAALAGRGAARPTAQLAADDEIALSSVGAKRQATLNR
LLFPSPTKEFNEHREAYGDTSQLSANQFFYGLRQGEEHRVKLERGVELLIGLEAISEPDE
RGMRTVMCILNGQLRPVLVRDRSIASAVPAAEKADRGNPGHIAAPFAGVVTVGVCVGERV
GAGQTIATIEAMKMEAPITAPVAGTVERVAVSDTAQVEGGDLLVVVS
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
gtgttttccaaggtgctcgtcgccaatcgcggggagatcgcgatccgggcctttcgtgcc
gcctacgaactgggcgtcggaaccgtggccgtttatccgtacgaggaccgcaattcgcag
caccgtctcaaggcggacgagtcttaccagatcggcgacatcggtcacccggtgcatgca
tacctgtcggtcgacgagatcgtcgcgacggcccgtcgggcgggtgccgacgctatctac
cctggctacgggtttctatcggagaatccggatctggctgcggcatgcgcggcggcgggc
atcagcttcgtcggtcccagcgccgaagtgcttgagctggctgggaataagtctcgcgcc
atcgcggcggcccgcgaagccggcttgcccgtgctgatgtcctcggcgccgtcggcctcg
gtcgacgaactgctgtcggttgcggccggcatgccgtttccgttgttcgtcaaggcagtt
gccggtggcgggggccggggtatgcgtcgtgtcggcgatatcgcggcgcttccggaggcg
atcgaagccgccagccgggaagccgagtcggcgttcggggacccgacggtctatctcgag
caggcagtgatcaatccacgccacatcgaggtgcagattctggcggacaacctcggcgac
gtgatccatctctatgagcgtgactgcagtgtgcagcgtcgccatcagaaggtcatcgag
ctggcgcccgcgccgcacctggacgccgagttgcgttacaagatgtgcgtcgatgcggtc
gccttcgcccgccatatcgggtacagctgcgcgggcaccgtcgagttcctgctggacgag
cgaggggagtatgtcttcatcgagatgaatccgcgggttcaggtggagcacacggtgacc
gaggagattaccgacgtcgacctggtcgccagccagctgcgcattgccgccggggagacg
ctcgaacaattgggcctgcggcaggaggacatcgcaccgcatggcgccgcactacagtgc
cggatcaccaccgaggatccggccaacggcttccggccggacacgggccggatcagcgcg
ttgcgcaccgccggcggtgccggtgtccgcctggacggcagcaccaacctgggcgcagaa
atcagcccgtacttcgactccatgctggtcaagctgacctgtcggggccgtgacctccct
accgcagtgagccgtgcgcgccgggcgatcgcggagttccggatccgcggggtatcgacg
aatattccgttcctgcaagcggtcctggatgacccggacttccgagcgggccgggtcacc
acgtccttcattgatgagcggccgcagctgctgaccgcgcgcgcctcggccgaccgcggc
accaagatccttaacttcctggccgatgtcaccgtcaacaacccgtatggctcgcgtccg
tcaacgatctacccggacgacaagctgcccgatcttgatctgcgggccgcaccaccggcc
gggtccaagcagcgactagtcaagttggggccggaaggatttgctcgttggctgcgggag
tcggccgcggtcggggtcaccgataccacattccgggatgctcaccagtcgttactggct
acccgagtacgcaccagcggactgtcgcgggtggcaccgtatctcgcgcggaccatgccg
cagctgttgtccgtggagtgttggggcggtgcgacttacgatgtggcgctgcgctttctc
aaggaggatccctgggaacggctggccacactgcgtgcagcaatgcccaatatctgcttg
cagatgctattgcggggccgcaataccgtgggctacacgccgtacccggaaatcgtgacg
tcggcgtttgtgcaagaagcaacagccaccggtatcgacatctttcgtatcttcgacgcg
ctcaacaacatcgagtcgatgcgtccggcgatcgacgcagtacgcgaaacaggttctgcg
atagcagaagtcgcgatgtgctacacgggcgaccttaccgatccgggtgaacagctgtac
acgctggactactacctgaaactggctgagcagatcgtggacgccggcgcccatgtgctg
gcgatcaaggatatggctggactgttgcgcccgccggccgctcaaaggttggtcagcgcc
ctgcgcagtcgcttcgacctgcccgttcacctgcacacccacgacacaccgggtggccag
ctcgccagctatgtggccgcttggcacgccggggccgatgccgtcgacggcgccgccgcg
ccgctggcgggaacgaccagccagcccgcgctgagctcgatcgttgctgccgctgcccac
accgagtacgacaccggcctgtcgctttcggcggtgtgcgccctggagccgtactgggag
gcgttacgaaaagtgtatgcgccgttcgagtctgggttgccggggccgacggggcgggtt
tatcaccacgagattccgggcggccaactgtccaatctgcgccagcaagcaattgctctt
ggtctgggagatcgattcgaagagatcgaagaggcctacgcgggcgccgaccgagtgttg
ggcaggctggttaaggtcacgccaacgtccaaggtggtcggcgatctggcgctggcactg
gtcggcgccggtgtcagtgcagacgaattcgcctccgatccagcgcgatttggcatcccg
gaatcggtactcggatttctgcggggcgagctgggtgatccgcccggcgggtggcccgaa
ccgctgcgcactgcggcgctggccggtcgcggggcggccaggcccactgcgcaattggcg
gcggacgacgagattgccctatcgtcggtcggagccaagcgtcaggccaccctgaacagg
ctgttatttcccagtccaacaaaggaattcaatgagcaccgggaagcctacggcgacacg
tcgcaattgtcggccaaccagttcttctatggtctgcgccaaggtgaagagcatcgggtg
aagctggagcgtggggtggagctgttgatcgggctggaggccatttccgaacccgacgaa
cgcggcatgcgaacggtgatgtgcatcctcaacgggcagctgcggccggtgctagtgcgc
gaccgcagcattgccagtgccgttccggccgccgagaaggccgaccgcggcaatcccgga
cacatcgccgcgccatttgccggagtcgtcacggtcggggtgtgcgtcggcgagcgggtc
ggcgccggccaaaccatcgccaccatcgaggcgatgaagatggaagccccgatcaccgcc
ccggttgccggcaccgtggagcgggtggcggtgtcggacaccgcccaggtggagggcgga
gacctgttggtggtggtgagctga

DBGET integrated database retrieval system