KEGG   Mycobacterium tuberculosis F11: TBFG_13747Help
Entry
TBFG_13747        CDS       T00545                                 

Definition
(GenBank) recombination protein recR
  KO
K06187  
recombination protein RecR
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mtf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TBFG_13747
DNA repair and recombination proteins [BR:mtf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     TBFG_13747
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TBFG_13747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(4172890..4173501)
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCG
NVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQ
LRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRVLA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagggacccgtccaggacctgattgacgaactcggcaagttgccggggatcgga
cccaagagtgcgcagcgaatcgccttccacctgttgtcggtagaaccgtcggacatcgac
cggctgaccggtgtgctggcgaaggttcgggacggcgtgcgattctgcgcggtgtgtggg
aatgtctctgacaacgagcgttgcagaatctgctctgatatccgtcgcgatgcgtccgtg
gtgtgcattgtcgaggaacccaaagacatccaggccgtcgagcgcacccgcgagttccgg
ggtcgctatcacgtcctgggcggggcgcttgacccgctgtccggaattgggccggatcag
ctgcggatccgcgaactgctgagccgcatcggggaacgggtcgacgacgtcgacgtcacc
gaggtcatcatcgccaccgaccccaacaccgagggcgaggcgacggccacctacctggtg
cgaatgctgcgcgacatccccggcctgaccgtcacacggatcgcgtccgggctgccgatg
ggcggtgacctggaattcgccgacgagctcaccctgggccgagcgctcgccggccgccgc
gtgctcgcctga

DBGET integrated database retrieval system