KEGG   Mycobacterium tuberculosis F11: TBFG_13808Help
Entry
TBFG_13808        CDS       T00545                                 

Definition
(GenBank) enoyl-CoA hydratase echA21
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtf  Mycobacterium tuberculosis F11
Pathway
mtf00071  Fatty acid degradation
mtf00280  Valine, leucine and isoleucine degradation
mtf00281  Geraniol degradation
mtf00310  Lysine degradation
mtf00360  Phenylalanine metabolism
mtf00362  Benzoate degradation
mtf00380  Tryptophan metabolism
mtf00410  beta-Alanine metabolism
mtf00627  Aminobenzoate degradation
mtf00640  Propanoate metabolism
mtf00650  Butanoate metabolism
mtf00903  Limonene and pinene degradation
mtf00930  Caprolactam degradation
mtf01100  Metabolic pathways
mtf01110  Biosynthesis of secondary metabolites
mtf01120  Microbial metabolism in diverse environments
mtf01130  Biosynthesis of antibiotics
mtf01212  Fatty acid metabolism
Module
mtf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TBFG_13808
   00650 Butanoate metabolism
    TBFG_13808
  Lipid metabolism
   00071 Fatty acid degradation
    TBFG_13808
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBFG_13808
   00310 Lysine degradation
    TBFG_13808
   00360 Phenylalanine metabolism
    TBFG_13808
   00380 Tryptophan metabolism
    TBFG_13808
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TBFG_13808
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TBFG_13808
   00281 Geraniol degradation
    TBFG_13808
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBFG_13808
   00627 Aminobenzoate degradation
    TBFG_13808
   00930 Caprolactam degradation
    TBFG_13808
Enzymes [BR:mtf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TBFG_13808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABR08133
Position
4231850..4232674
Genome map
AA seq 274 aa AA seqDB search
MGETYESVTVETKDQVAQVTLIGPGKGNAMGPAFWSEMPEVFHALDADREVRAIVITGSG
KNFSYGLDVPAMGGMFAPLIADGALARPRTDFHTEILRMQKAINAVADCRTPTIAAVQGW
CIGGAVDLISAVDIRYASADAKFSVREVKLAIVADMGSLARLPLILSDGHLRELALTGKN
IDAARAEKIGLVNDVYDDADQTLAAAHATAAEIAANPPLAVYGIKDVLDQQRTSAVSENL
RYVAAWNAAFLPSKDLTEGISATFAKRPPQFTGE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaaacctacgaatccgtcaccgtcgaaaccaaggaccaggtcgcgcaggtgacg
ctgatcgggccgggcaagggcaacgcgatggggcccgcattctggtcggagatgcccgag
gtgttccatgccctggacgccgaccgtgaggtgcgggccatcgtcatcaccggatcgggc
aagaacttcagctacggcctggacgtaccggccatgggcggaatgttcgccccgttgatc
gccgacggcgcgctggcccgcccacgcacggacttccacaccgaaatactgcgcatgcag
aaggcgatcaacgccgtcgccgactgccgcacccccacgatcgcggccgtccagggttgg
tgcatcggcggcgccgtcgacctgatctccgcggtcgacatccggtatgccagcgccgac
gcgaagttctcggtgcgcgaggtcaagctagcgattgttgccgacatgggcagcctggcg
cgccttccactaatcctgagcgacggccatctacgagaactcgcgctgaccggcaaaaat
atcgacgcggcccgcgccgagaagatcggcctggtcaacgacgtctacgatgacgccgac
cagacgctggccgcggcccacgcgactgccgccgagatcgccgccaacccacctttggcg
gtctacggcatcaaggacgttctcgaccaacaacgcacgtccgccgtctcggagaacctg
cgctatgtcgccgcctggaacgccgcgtttctgccgtccaaggacctcaccgaaggtatt
tccgcgacgttcgccaagcgcccgccccagttcaccggcgagtag

DBGET integrated database retrieval system