KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_04225Help
Entry
MRGA327_04225     CDS       T01775                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MRGA327_04225
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MRGA327_04225
   00650 Butanoate metabolism
    MRGA327_04225
  Lipid metabolism
   00071 Fatty acid degradation
    MRGA327_04225
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRGA327_04225
   00310 Lysine degradation
    MRGA327_04225
   00360 Phenylalanine metabolism
    MRGA327_04225
   00380 Tryptophan metabolism
    MRGA327_04225
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRGA327_04225
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MRGA327_04225
   00281 Geraniol degradation
    MRGA327_04225
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRGA327_04225
   00627 Aminobenzoate degradation
    MRGA327_04225
   00930 Caprolactam degradation
    MRGA327_04225
Enzymes [BR:mtg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MRGA327_04225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
775260..776051
Genome map
AA seq 263 aa AA seqDB search
MSDLVRVERKGRVTTVILNRPASRNAVNGPTAAALCAAFEQFDRDDAASVAVLWGAGGTF
CAGADLKAFGTPEANSVHRTGPGPMGPSRMMLSKPVIAAVSGYAVAGGLELALWCDLRVA
EEDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRGVPADEALAMGLANRVVP
KGQARQAAEELAAQLAALPQQCLRSDRLSALHQWGLPESAALDLEFASIARVAGEALEGA
RRFAAGAGRHGAPAPRAEQGDTL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatctggtgcgtgtggagcgcaaaggtcgggtgaccacggtgattctgaaccgg
ccggcctcccgcaacgcggtcaacggcccgaccgccgcggcgttgtgcgcggcgttcgag
caattcgaccgggacgacgccgcgtcggtggccgtactctggggtgcgggtggaaccttt
tgtgcgggagccgatttgaaggcctttggcacaccggaggccaactctgtgcaccggacg
ggtcccggcccgatggggccgtcacgaatgatgctgtccaaacctgtgatcgccgccgtc
agcggctacgccgtcgccggggggctggaattggcactgtggtgcgacctgcgggtggcc
gaggaagacgccgtgttcggtgtgttttgccgtcgctggggggtaccgctcatcgacggc
ggcaccgtgcgactgccacggctgatcgggcacagccgcgcgatggacatgatcctcact
ggccgtggggtgccggccgacgaagcgctggccatggggttggccaatcgggtggtgccc
aagggtcaagcccgacaggcggctgaggagttggcggcgcaattggccgcgctgccgcag
cagtgtctgcgatcggatcggctgtcggcgctgcaccagtggggcctgcccgagtccgcg
gcgctcgacctcgagttcgccagcatcgcgcgggtggccggcgaggcgctagagggggcg
agacggttcgccgcgggtgccggtcggcatggggccccggcacctcgggccgaacagggc
gacacgctttag

DBGET integrated database retrieval system