KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_05395Help
Entry
MRGA327_05395     CDS       T01775                                 

Definition
fatty oxidation protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MRGA327_05395
   01212 Fatty acid metabolism
    MRGA327_05395
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MRGA327_05395
   00650 Butanoate metabolism
    MRGA327_05395
  Lipid metabolism
   00071 Fatty acid degradation
    MRGA327_05395
   01040 Biosynthesis of unsaturated fatty acids
    MRGA327_05395
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRGA327_05395
   00310 Lysine degradation
    MRGA327_05395
   00380 Tryptophan metabolism
    MRGA327_05395
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRGA327_05395
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MRGA327_05395
   00281 Geraniol degradation
    MRGA327_05395
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    MRGA327_05395
Enzymes [BR:mtg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MRGA327_05395
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MRGA327_05395
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MRGA327_05395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
956862..958088
Genome map
AA seq 408 aa AA seqDB search
MPDNTIQWDKDADGIVTLTMDDPSGSTNVMNEAYIESMGKAVDRLVAEKDSITGVVVASA
KKTFFAGGDVKTMIQARPEDAGDVFNTVETIKRQLRTLETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGSQLGLPEVTLGLLPGGGGVTRTVRMFGIQNAFVSVLAQGTRFKPAK
AKEIGLVDELVATVEELVPAAKAWIKEELKANPDGAGVQPWDKKGYKMPGGTPSSPGLAA
ILPSFPSNLRKQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFASLVTGQVAKNMM
QAFFFDLQAINAGGSRPEGIGKTPIKRIGVLGAGMMGAGIAYVSAKAGYEVVLKDVSLEA
AAKGKGYSRKAGGQGAGAGPHHTGAQATPCWRASPRPPTPPISRALIS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccagacaacacaatccagtgggacaaggatgccgacggcatcgtcacgctgaccatg
gacgatccctccgggtcaaccaacgtgatgaacgaggcctacatcgagtcgatgggcaag
gccgtcgatcgccttgtcgccgaaaaggattcgatcaccggagtggtagtcgccagcgcg
aagaaaaccttcttcgccggcggcgacgtcaagacgatgatccaggccaggcccgaggac
gccggcgatgtattcaacaccgtcgagaccatcaagcggcagctgcgcaccttggagaca
ttgggtaagccggtcgtcgcggccatcaacggggcggcgttgggcggcggcctggagatc
gcgctggcgtgtcatcaccggatcgccgccgacgtcaagggcagccagctcggtctgccg
gaggtgacgctgggtctgctgccgggtggcggtggggtgacccgcacggtacggatgttc
ggcatccagaacgcgttcgtgagcgtgctggcgcaaggtacccggttcaagccggccaag
gccaaggagatcggtctggtcgacgagctggtggcaacggtcgaggagctggtgcccgcc
gccaaggcttggataaaggaggagctcaaggccaaccccgacggtgccggggtgcagccg
tgggacaagaagggctacaagatgcccggcggcaccccgtcgtcgccgggtctggcggcg
attttgccgtcgttcccgtcgaacctgcgcaagcagctcaagggtgccccgatgccggcg
ccgcgggccatcctggccgccgcggtcgagggggcacaggtcgatttcgacaccgccagc
cgcatcgagagccgctacttcgcgtcgttggtcaccggccaggtcgccaagaacatgatg
caggcgttcttcttcgacctgcaggccatcaatgccggcgggtctcggcccgaaggcatc
ggcaagaccccgatcaagaggatcggtgtgctgggtgcgggcatgatgggcgccggcatc
gcctacgtctctgccaaggccggctatgaggtggtactcaaagatgtcagccttgaggcc
gccgctaaaggcaagggctactcccgaaaagctggaggccaaggcgctggagcggggccg
caccacacaggagcgcaagcgacgccctgctggcgcgcatcaccccgaccgccgacgccg
ccgatttcaagggcgttgatttcgtga

DBGET integrated database retrieval system