KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_05925Help
Entry
MRGA327_05925     CDS       T01775                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MRGA327_05925
Enzymes [BR:mtg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MRGA327_05925
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MRGA327_05925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1054484..1054885
Genome map
AA seq 133 aa AA seqDB search
MAGNTGRIKTVITDQKVIAGIGNAYSDEILHVAKISPFATAGKLSGAQLTCLHEAMASVL
SDAVRRSVGQGAAMLKGEKRSGLRVHARTGLPCPVCGDTVREVSFADKSFQYCPTCQTGG
KALADRRMSRLLK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
ttggccggcaacaccggccggatcaagaccgtcatcaccgaccagaaggtaattgccggc
atcggcaacgcctatagtgacgaaatcctgcacgtcgcgaagatctcgccgttcgccacg
gccggcaagttatccggcgcacagctcacctgcctgcatgaggcgatggcgtcggtgctg
tcggacgcggtgcgccggtccgtcggccagggcgcggccatgctcaaaggggagaaacgt
tctgggcttcgagtacatgcgcgcaccgggttaccctgcccagtgtgcggtgacaccgtg
cgggaggtgtccttcgcggacaagtcttttcagtactgtccaacgtgtcagaccggtggc
aaggcgctggccgaccggcgtatgtcgcggctgctcaagtag

DBGET integrated database retrieval system