KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_06350Help
Entry
MRGA327_06350     CDS       T01775                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mtg00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
1130884..1131804
Genome map
AA seq 306 aa AA seqDB search
MPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEG
ADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSL
WELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLL
TSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARA
LRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVV
SAPTEV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaccgggtcggtcaccgttcgggtgcccggaaaggtcaacctctatctggcggtc
ggcgatcgccgcgaggacggctatcacgagctgaccacggtatttcatgccgtctcgctg
gtcgacgaggtaaccgttcgtaacgctgatgtgctctcgctcgagttggtcggcgagggg
gccgaccagctgccgaccgacgaacgcaatctcgcctggcaggcggccgagctgatggcc
gaacacgtgggccgggcgccggacgtctcgatcatgatcgacaaatccattccggtcgcc
ggcggcatggccggtggcagcgcggacgctgcggcggtcctggttgcgatgaactcgttg
tgggaactcaatgtgccccgccgcgacctgcgcatgctcgccgcgcggctaggcagcgat
gtgccgtttgccctgcatggtggtaccgcgctggggacgggtcgcggcgaggagttggcc
accgtgttatcccgcaacaccttccactgggtcctggcgttcgccgacagcgggttgctc
acctccgcggtgtacaacgagctcgaccggctcagggaggtgggggatccgccccggctt
ggtgagcccgggccggttctggctgccttagctgcgggtgatccggatcagctggcgccg
ttgctgggtaatgaaatgcaagcggccgcggtgagcctggacccggcgctggctcgtgcg
ttacgcgccggtgtggaggccggcgcgctcgcaggcatcgtgtccggttcgggtcccacg
tgtgccttcctgtgcacctcggcgagctcggcgatcgatgtcggcgcgcagctgtcgggg
gcgggagtttgtcgcaccgttcgagtcgccaccgggccggtacccggcgcccgcgtggtg
tctgcgccgaccgaagtgtga

DBGET integrated database retrieval system