KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_06810Help
Entry
MRGA327_06810     CDS       T01775                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MRGA327_06810
Enzymes [BR:mtg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MRGA327_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1216356..1216928
Genome map
AA seq 190 aa AA seqDB search
MGQILSAPTSIDYNYPTTGVWDASYDICLDSTPKTTGVNQQEIMIWFNHQGSIQPVGSPV
GNTTIEGKNFVVWDGSNGMNNAMAYVATEPIEVWSFDVMSFVDHTATMEPITDSWYLTSI
RAGLEPWSDGVGLGVDSFSAKVKRKPHVDTQPAARHGPSRRRSFDRGAKRSLLRPMQIAH
ACLNIGWSRW
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgggccagattttgtcggcgccgaccagcatcgactacaactacccgacgaccggggta
tgggacgcctcctacgacatctgcctggattccacacccaagacgaccggggtcaaccag
caggagatcatgatctggttcaaccaccagggctccattcagccggtcggctccccggtg
ggcaacaccaccatcgagggcaagaacttcgtggtgtgggatggcagcaacggcatgaac
aacgcgatggcctatgtcgcgaccgagccgatcgaggtctggagcttcgacgtgatgagt
ttcgtcgaccacaccgccaccatggagccgatcaccgactcgtggtacctcacgagcatc
cgggccggcttggagccctggagcgacggtgtgggtctgggggtcgattcgttctcggcg
aaagtcaaaagaaaaccccacgttgacacccaaccggcggcccggcatgggccgtcgcgg
cgtagaagctttgaccgcggcgcgaaacgttcgctgctgcggcccatgcagatcgcacac
gcttgcttgaacatcgggtggagccggtggtaa

DBGET integrated database retrieval system