KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_07145Help
Entry
MRGA327_07145     CDS       T01775                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
mtg00071  Fatty acid degradation
mtg00280  Valine, leucine and isoleucine degradation
mtg00281  Geraniol degradation
mtg00310  Lysine degradation
mtg00360  Phenylalanine metabolism
mtg00362  Benzoate degradation
mtg00380  Tryptophan metabolism
mtg00410  beta-Alanine metabolism
mtg00627  Aminobenzoate degradation
mtg00640  Propanoate metabolism
mtg00650  Butanoate metabolism
mtg00903  Limonene and pinene degradation
mtg00930  Caprolactam degradation
mtg01100  Metabolic pathways
mtg01110  Biosynthesis of secondary metabolites
mtg01120  Microbial metabolism in diverse environments
mtg01130  Biosynthesis of antibiotics
mtg01212  Fatty acid metabolism
Module
mtg_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MRGA327_07145
   00650 Butanoate metabolism
    MRGA327_07145
  Lipid metabolism
   00071 Fatty acid degradation
    MRGA327_07145
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRGA327_07145
   00310 Lysine degradation
    MRGA327_07145
   00360 Phenylalanine metabolism
    MRGA327_07145
   00380 Tryptophan metabolism
    MRGA327_07145
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRGA327_07145
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MRGA327_07145
   00281 Geraniol degradation
    MRGA327_07145
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRGA327_07145
   00627 Aminobenzoate degradation
    MRGA327_07145
   00930 Caprolactam degradation
    MRGA327_07145
Enzymes [BR:mtg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MRGA327_07145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 YdjM
Motif
Other DBs
NCBI-ProteinID: AFE16085
Position
complement(1268972..1269778)
Genome map
AA seq 268 aa AA seqDB search
MPDSGIAALTPVTGLNVTLTDRVLSVRINRPSSLNSLTVPILTGIADTLERAAADPVVKV
VRLGGVGRGFSSGVSMSVDDVWGGGPPTAIVEEANRAVRAVAALPHPVVAVVQGPAVGVA
VSLALACDFILASDSAFFMLANTKVALMPDGGASALVAAATGRIRAMRLALLAEQLPARE
ALAWGLISAVYPDSDFEAEVDKVISRLLAGPALAFAQAKNAINAAALTELEPTFARELDG
QEVLLRTHDFAEGAAAFLQRRTPNFTGS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgccagattccgggattgccgcattaacgccggtcacaggcctcaacgtcaccctgacc
gacagagtgttgtcggtgcgcatcaaccgccctagcagtctcaactcgctgaccgtgcca
atcctgacggggatcgccgacacgctggagcgcgcggcggccgatcccgtggtcaaggtg
gtgcgcctaggcggggtgggccgcggtttcagctccggagtgtctatgtctgtggacgat
gtgtggggcggagggccgccgaccgccatcgtcgaagaggccaaccgcgcagtacgcgcc
gtggccgcgctaccgcacccggttgtagctgtcgttcaaggaccagcggtcggcgtcgct
gtctcgctagcgctggcgtgtgacttcatattggcttctgatagtgcatttttcatgctc
gccaacaccaaggtagcgttgatgcccgacggcggcgcatcggcgttagtcgccgcggcc
accggccggatccgggcgatgcggctggcgctgctggccgagcaactgccggcccgcgag
gcactggcctggggcctgatcagcgcggtatatccggacagcgacttcgaggccgaggtg
gacaaggtgatttcacggttgctggccggcccggcgctggcgttcgcccaggccaaaaac
gccatcaatgcagccgccctcaccgaattggaacccacgttcgcgcgcgaattggatgga
caggaagtcctgctgcgaacacacgacttcgccgagggcgcagcggcgttcctgcaacgc
cgcacccccaacttcaccggttcctga

DBGET integrated database retrieval system