KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_08115Help
Entry
MRGA327_08115     CDS       T01775                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MRGA327_08115
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MRGA327_08115
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MRGA327_08115
Enzymes [BR:mtg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MRGA327_08115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1451748..1452656
Genome map
AA seq 302 aa AA seqDB search
MEGLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQG
KIAMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAF
EIVDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQLGLIDKLPRMLGTQAAGAAPLVLGE
PVSHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPA
SAASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALKDMPSVSPVPVDPVAVVEKLG
LA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggagggcctcaaccccaccggctccttcaaggatcgtggcatgacgatggcggtcacc
gatgcccttgcccatggtcagcgggcggtcttgtgcgcatcgaccggaaatacctcggcg
tcggcggcggcctatgccgcccgggccggcatcacctgcgcggtgctgataccgcagggc
aagatcgcgatgggcaagctcgcacaggcggtcatgcacggcgccaagatcatccagatc
gacggtaacttcgacgactgcctggaactggcgcgcaagatggccgcggacttcccgacg
atttcgttggtcaactcggtaaacccggtgcgcatcgagggccagaaaacggcagcgttc
gagatcgtcgacgtgctaggtaccgcgccggacgtgcatgctctgccggttggcaacgcc
ggcaacatcaccgcgtactggaagggctacaccgagtatcaccagctgggcctgatcgac
aagttgccccgcatgctgggcactcaggccgcgggcgcggcgcccctggtgctcggcgaa
ccggtgagccacccggagaccatcgcaaccgcgatccgcatcggctcgccggcgtcgtgg
acttcggccgtcgaggcacagcagcagtccaagggccgcttcttggccgcctccgacgag
gagatactggccgcatatcacctggtggctcgtgtcgaaggcgtattcgtggagcccgcg
tccgcagccagcattgcgggtctcctcaaagcgatcgacgacggctgggtggcgcgtggt
tcgacggtggtgtgcacggtaaccggcaacggtcttaaggatcccgacaccgcgctcaaa
gacatgccgagcgtgtctccggttcccgtggacccggtagccgtcgtcgagaagctaggg
ctggcctag

DBGET integrated database retrieval system