KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_09940Help
Entry
MRGA327_09940     CDS       T01775                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtg01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mtg00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1794672..1795988
Genome map
AA seq 438 aa AA seqDB search
MLTRIDLRGAELTAAELRAALPRGGADVEAVLPTVRPIVAAVAERGAEAALDFGASFDGV
RPHAIRVPDAALDAALAGLDCDVCEALQVMVERTRAVHSGQRRTDVTTTLGPGATVTERW
VPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVDSLVVASPPQAQWDGMPHPTILAAARL
LGVDEVWAVGGAQAVALLAYGGTDTDGAALTPVDMITGPGNIYVTAAKRLCRSRVGIDAE
AGPTEIAILADHTADPVHVAADLISQAEHDELAASVLVTPSEDLADATDAELAGQLQTTV
HRERVTAALTGRQSAIVLVDDVDAAVLVVNAYAAEHLEIQTADAPQVASRIRSAGAIFVG
PWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVSGHVITLA
TAEDLPAHGEAVRRRFER
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgcttacccgtatcgacttgcggggagccgagttgacagctgccgagctgcgggccgct
ctgccacgcggcggcgccgatgtggaagccgtgctgccgacggtacggcccattgtggcg
gccgtcgccgagcgcggggccgaggccgcgctggacttcggcgcatcgttcgacggtgtg
cggccccatgccatccgggtgccagacgcagcgctggacgcggcgctggccggactggac
tgcgacgtctgcgaagcgttgcaggtgatggtcgagcggacccgcgccgtgcactccggg
cagcgtcgcaccgacgtcacaaccacactgggcccgggcgcgacggtcaccgagcggtgg
gttccggtcgagcgggtaggcctgtacgtgccggggggcaatgcggtgtacccatccagc
gtggtgatgaacgtggtgcccgcccaagccgcgggcgtcgactcgttggtggtagccagc
ccgccgcaggcgcagtgggatggaatgccgcatccgaccattctggccgcggcccggctg
ctgggcgtcgatgaggtctgggcggtcggcggcgctcaggcggtggcgttgctggcttac
ggcggcaccgacaccgacggcgcagcactgacaccggtcgacatgatcaccgggcctggc
aacatctatgtcacggccgccaagcgactgtgccgttcgcgggtgggcatcgacgccgaa
gcggggccaaccgagatcgctatcctcgccgatcacaccgccgacccggtgcatgtggcc
gccgacctgattagccaggccgaacacgacgagttggctgccagcgtgctggtcactccg
agtgaggacctggccgatgccaccgacgccgaactggctggccagctgcagactacggtg
caccgcgaacgggtgacggccgcgctgaccggacgccaatcggcgatcgtcctggtcgac
gacgtggacgccgccgtcttggtggtgaacgcttacgccgctgagcatttggagattcag
accgccgatgccccgcaggttgccagccggatccgctcggcgggagccattttcgtcggc
ccgtggtccccggtgagcctcggcgactactgcgcgggatccaaccatgtactgccgacc
gcgggctgcgcccggcattccagcggcctgtcggtgcagacgttcctgcgcggcatccac
gtcgtggaatacacggaggcggccctcaaagacgtttccggacacgtgatcacgctcgcc
acggccgaggacttgccggcgcacggtgaggcggtacggcggaggttcgagcgatga

DBGET integrated database retrieval system