KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_10000Help
Entry
MRGA327_10000     CDS       T01775                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
mtg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtg01100  Metabolic pathways
mtg01110  Biosynthesis of secondary metabolites
mtg01130  Biosynthesis of antibiotics
mtg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MRGA327_10000 (trpC)
Enzymes [BR:mtg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MRGA327_10000 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS OMPdecase FMN_dh
Motif
Other DBs
NCBI-ProteinID: AFE16514
Structure
PDB: 

Jmol
Position
1805331..1806149
Genome map
AA seq 272 aa AA seqDB search
MSPATVLDSILEGVRADVAAREASVSLSEIKAAAAAAPPPLDVMAALREPGIGVIAEVKR
ASPSAGALATIADPAKLAQAYQDGGARIVSVVTEQRRFQGSLDDLDAVRASVSIPVLRKD
FVVQPYQIHEARAHGADMLLLIVAALEQSVLVSMLDRTESLGMTALVEVHTEQEADRALK
AGAKVIGVNARDLMTLDVDRDCFARIAPGLPSSVIRIAESGVRGTADLLAYAGAGADAVL
VGEGLVTSGDPRAAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggcaaccgtgctcgactccatcctcgagggagtccgggccgacgttgccgcg
cgtgaagcctcggtgagcctgtcggagatcaaggctgccgccgctgcggcgccgccgccg
ctcgacgtgatggccgccctacgcgagcccggcatcggcgtcatcgctgaggtcaagcgc
gctagtccttcggcaggcgcattggcgaccatcgccgacccggcaaagctggcccaggcc
taccaggatggcggtgcccggatcgtcagcgtggtgactgagcagcggcgttttcaggga
tcgctcgacgacctcgacgcggtgcgggcctcggtttcgattccggtgctgcgcaaggac
tttgtggtgcagccgtaccagattcatgaggcgcgtgcgcacggcgccgacatgttgttg
ctcatcgtcgccgcattggagcagtcggtgttggtgtcgatgttggaccgcaccgaatcg
ttgggtatgacagcactcgtcgaggtccataccgagcaggaagccgaccgagcgctgaag
gccggggccaaggtgattggcgttaacgcccgcgacctcatgacgctggacgtggaccgg
gattgcttcgcgcgaatagctcctggtttgccgagcagtgtgatcaggattgctgaatcc
ggcgtgcgtggcaccgctgacctgctggcgtacgccggcgcgggcgctgacgcggtgttg
gtaggcgaaggtctggtcaccagcggcgacccacgtgccgcggttgccgatctggttacc
gcgggcacccatccgtcctgtccgaaaccggctcgctag

DBGET integrated database retrieval system