KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_10570Help
Entry
MRGA327_10570     CDS       T01775                                 

Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mtg00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1924298..1924888)
Genome map
AA seq 196 aa AA seqDB search
MLATIDKFAYEKSMLINVGDEKGTLLDAAVRRADPALALELGTYLGYGALRIARAAPEAR
VYSVELAEANASNARRIWAHAGVDDRVVCVVGTIGDGGRTLDALTEHGFATGTLDFVFLD
HDKKAYLPDLQSILDRGWLHPGSIVVADNVRVPGAPKYRAYMRRQQGMSWNTIEHKTHLE
YQTLVPDLVLESEYLG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgctggccaccatcgacaagttcgcctatgagaagtcgatgctcatcaacgtcggtgac
gagaaagggacgctgctcgacgcggcggttcggcgcgccgacccggcattggcgctggag
ttgggcacctacctcggctacggcgcgctgcggatcgcccgggccgctccggaggccagg
gtgtactccgtcgaactcgccgaagccaacgccagcaacgcccggcgaatatgggcgcat
gccggcgtcgatgacagggtggtgtgcgtggtcggcaccatcggcgacggtgggcgcacc
ctggacgcgctaaccgagcacggattcgcaactggcacactcgattttgtgttcctcgac
catgacaagaaggcttacctgcccgatctgcagagcatcctagaccggggctggttgcac
ccgggctcgatcgtggttgccgacaatgtcagggtgcccggcgcgccgaagtaccgtgca
tatatgcgccggcaacaaggcatgtcatggaacaccattgagcacaagacgcacctcgaa
taccagaccctggtgcccgacttggtattggagtccgaatacctgggttag

DBGET integrated database retrieval system