KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_11805Help
Entry
MRGA327_11805     CDS       T01775                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mtg01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mtg00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2156924..2158009
Genome map
AA seq 361 aa AA seqDB search
MPARAKAKELGADPPWDCELAKTPEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADL
ADARQFAEAIHAEFPDQMLAYNLSPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGG
HQIDGVAAEEFATALRQDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRT
ATTKAMGKGSTQHQHLVQTEVPRKLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELG
IHGESDDKLANVIFQPIQDRRGRTILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAV
HYVTPTDDNLYQTSKMKSHGIFTEVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKE
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccgggcaaaggccaaggagctgggcgccgatccgccatgggactgcgagctg
gccaagaccccggagggctactaccagatccgcggcggcataccgtatgcgatcgccaaa
tcgctggccgcggcaccgtttgccgacattctttggatggagaccaagaccgccgatctc
gccgacgctcgacagttcgccgaggcgatccatgccgagttccccgaccagatgctggcg
tacaacctctcaccatcgttcaactgggacaccaccggcatgaccgacgaggagatgcgg
cgcttccccgaggagctcggcaaaatgggcttcgtcttcaacttcatcacctatggcggg
caccagatcgacggtgtcgcggccgaggaattcgccaccgcgctgcgccaggacggcatg
ctggcgctggctcggttgcagcgcaagatgcgcttggtcgaatctccctatcgcacaccg
caaacgctagtcggcgggccgcgcagtgacgccgcattggctgcctcctccggacgcacg
gcgaccacgaaggcaatgggcaagggctccacccagcaccagcacttggtgcaaactgag
gtgccgcgcaagctgctagaggaatggctggccatgtggagcggtcactaccagctcaaa
gacaaactgcgcgtacagcttcggccgcagcgggccggctcggaggtgctcgagctcggc
atccacggcgaaagcgatgacaagctcgccaacgtgatattccaaccgatccaagatcgc
cgcggccgcaccatcctgttggtacgcgaccagaacacgttcggtgcggaactacgccaa
aagcggctgatgaccctgatccacctctggctcgtccaccgcttcaaggcgcaggcggtg
cactacgtcacgcccaccgacgacaacctctaccagacctcgaagatgaagtcgcatgga
atcttcaccgaggtcaaccaggaggtgggcgagatcatcgtcgccgaggtgaaccacccg
cgcatcgccgaactgctgacgcccgatcgggtggcgctgcggaagttgatcacgaaggag
gcgtag

DBGET integrated database retrieval system