KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_11805Help
Entry
MRGA327_11805     CDS       T01775                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MRGA327_11805
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MRGA327_11805
Enzymes [BR:mtg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MRGA327_11805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2156924..2158009
Genome map
AA seq 361 aa AA seqDB search
MPARAKAKELGADPPWDCELAKTPEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADL
ADARQFAEAIHAEFPDQMLAYNLSPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGG
HQIDGVAAEEFATALRQDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRT
ATTKAMGKGSTQHQHLVQTEVPRKLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELG
IHGESDDKLANVIFQPIQDRRGRTILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAV
HYVTPTDDNLYQTSKMKSHGIFTEVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKE
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccgggcaaaggccaaggagctgggcgccgatccgccatgggactgcgagctg
gccaagaccccggagggctactaccagatccgcggcggcataccgtatgcgatcgccaaa
tcgctggccgcggcaccgtttgccgacattctttggatggagaccaagaccgccgatctc
gccgacgctcgacagttcgccgaggcgatccatgccgagttccccgaccagatgctggcg
tacaacctctcaccatcgttcaactgggacaccaccggcatgaccgacgaggagatgcgg
cgcttccccgaggagctcggcaaaatgggcttcgtcttcaacttcatcacctatggcggg
caccagatcgacggtgtcgcggccgaggaattcgccaccgcgctgcgccaggacggcatg
ctggcgctggctcggttgcagcgcaagatgcgcttggtcgaatctccctatcgcacaccg
caaacgctagtcggcgggccgcgcagtgacgccgcattggctgcctcctccggacgcacg
gcgaccacgaaggcaatgggcaagggctccacccagcaccagcacttggtgcaaactgag
gtgccgcgcaagctgctagaggaatggctggccatgtggagcggtcactaccagctcaaa
gacaaactgcgcgtacagcttcggccgcagcgggccggctcggaggtgctcgagctcggc
atccacggcgaaagcgatgacaagctcgccaacgtgatattccaaccgatccaagatcgc
cgcggccgcaccatcctgttggtacgcgaccagaacacgttcggtgcggaactacgccaa
aagcggctgatgaccctgatccacctctggctcgtccaccgcttcaaggcgcaggcggtg
cactacgtcacgcccaccgacgacaacctctaccagacctcgaagatgaagtcgcatgga
atcttcaccgaggtcaaccaggaggtgggcgagatcatcgtcgccgaggtgaaccacccg
cgcatcgccgaactgctgacgcccgatcgggtggcgctgcggaagttgatcacgaaggag
gcgtag

DBGET integrated database retrieval system