KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_13320Help
Entry
MRGA327_13320     CDS       T01775                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mtg00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mtg00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(2412391..2413998)
Genome map
AA seq 535 aa AA seqDB search
MSSLARGISRRRTEVATQVEAAPTGLRPNAVVGVRLAALADQVGAALAEGPAQRAVTEDR
TVTGVTLRAQDVSPGDLFAALTGSTTHGARHVGDAIARGAVAVLTDPAGVAEIAGRAAVP
VLVHPAPRGVLGGLAATVYGHPSERLTVIGITGTSGKTTTTYLVEAGLRAAGRVAGLIGT
IGIRVGGADLPSALTTPEAPTLQAMLAAMVERGVDTVVMEVSSHALALGRVDGTRFAVGA
FTNLSRDHLDFHPSMADYFEAKASLFDPDSALRARTAVVCIDDDAGRAMAARAADAITVS
AADRPAHWRATDVAPTDAGGQQFTAIDPAGVGHHIGIRLPGRYNVANCLVALAILDTVGV
SPEQAVPGLREIRVPGRLEQIDRGQGFLALVDYAHKPEALRSVLTTLAHPDRRLAVVFGA
GGDRDPGKRAPMGRIAAQLADLVVVTDDNPRDEDPTAIRREILAGAAEVGGDAQVVEIAD
RRDAIRHAVAWARPGDVVLIAGKGHETGQRGGGRVRPFDDRVELAAALEALERRA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcgctggcccgagggatctcgcggcggcgaacggaggtggcgacacaggtggag
gctgcgcccactggcttgcgccccaacgccgtcgtgggcgttcggttggccgcactggcc
gatcaggtcggcgcggccctggccgagggtccagctcagcgtgccgtcaccgaggaccgg
acggtcaccggggtcacgctgcgcgcccaggacgtgtcacccggtgacctgttcgccgcc
ctgaccggctcgaccacccacggggcccgccacgtcggcgacgcgatcgcacgcggcgcc
gtcgcggtgctcaccgaccccgccggggtcgccgagatcgccggacgagcggccgtgccc
gtgttggtgcaccccgcaccccgcggcgtgctcggcggcttggccgccaccgtgtacggg
catccgtccgagcggttgacggttatcgggatcaccggaacgtccggcaagaccaccacc
acctatctggtcgaggccgggttacgggctgccggacgcgtcgccgggctgatcggcacc
atcggcatccgcgtcggcggcgccgaccttcccagcgcgctgaccaccccggaggccccc
acgctgcaggcgatgctggcggcgatggtcgaacgcggggtggacaccgtggtcatggag
gtgtccagccacgcgctggcgctgggccgggtggacggcacccggttcgccgtcggcgcc
ttcaccaatctctcccgtgaccacctggatttccaccccagcatggccgactacttcgag
gccaaggcgtcattgttcgatccggactcggcactgcgcgcccgcaccgccgtggtgtgc
atcgacgacgacgccgggcgcgcgatggcggcgcgggccgccgacgcgatcaccgtcagc
gccgccgaccggcccgcacactggcgcgccacggatgtggcgcccacggacgcgggcggg
caacaattcaccgccatcgaccccgccggcgtagggcatcacatcggaatccggctaccg
ggccgctacaacgtcgccaattgcctggtcgccctggcgattctggacaccgtcggggtc
tccccggaacaggcggtgccgggcctgcgtgagatccgggtcccggggcggctcgagcag
atcgaccgcggccagggctttctcgcgctggtcgactacgcgcacaaaccggaagcgctg
cggtcggtgctgaccaccttggcgcacccggaccgccggctggcggtggtgttcggcgcc
ggcggcgatcgtgacccgggcaagcgggccccgatgggccggatagccgcgcagctggcc
gacttggtggtcgtcaccgacgacaacccgcgtgacgaagatcccacggcgatccgccgc
gaaatcctggctggggcggccgaagtcggcggtgatgcccaggtcgtcgagatcgcagac
cggcgggacgcgatccggcacgcggttgcctgggcgcgccccggcgacgtggtgctcatc
gccggcaaaggccacgagaccgggcaacgcggcggcgggcgggtccgcccgttcgacgac
cgggtggagctggctgccgcgctagaggccctcgagcggcgcgcatga

DBGET integrated database retrieval system