KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_16945Help
Entry
MRGA327_16945     CDS       T01775                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mtg00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mtg00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3066929..3067138)
Genome map
AA seq 69 aa AA seqDB search
MGDRRRTSLCARALPYATRCEVTEVDIGLPREAGDALAPVLDETWRGETGEWRFSRSGLR
YRLYSYHRS
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgatcggaggcggacaagtctatgcgccagggcgctgccgtacgcgaccagatgt
gaggttaccgaggtcgacatcggcctgccgcgcgaagccggtgacgcgctggcccccgtg
ctggacgagacatggcggggcgagacgggggagtggcgcttcagccggtccgggttgcgg
taccggttgtacagctaccaccgctcatga

DBGET integrated database retrieval system