KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_17465Help
Entry
MRGA327_17465     CDS       T01775                                 

Definition
putative magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MRGA327_17465
Enzymes [BR:mtg01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MRGA327_17465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3152043..3153932)
Genome map
AA seq 629 aa AA seqDB search
MKPYPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALLSVATGSTE
TGLVELPLGATEDRVVGSLDLQRVMRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDI
LLDAAAMGRVHVERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVQASRDIDV
RVQVIRRRMAYEADPDAFVARYADADAELAHRIAAARATVDDVVLGDNELRRIAALCAAF
DVDGMRADLVVARTAAAHAAWRGVRTVEEQDIRAAAELALPHRRRRDPFDDHGIDRDQLD
EALALASVDPEPEPDPPGGGQSANEPASQPNSRSKSTEPGAPSSMGDDPPRPASPRLRSS
PRPSAPPSKIFRTRALRVPGVGTGAPGRRSRARNASGSVVAAAEVSDPDAHGLHLFATLL
AAGERAFGAGPLRPWPDDVRRAIREGREGNLVIFVVDASGSMAARDRMAAVSGATLSLLR
DAYQRRDKVAVITFRQHEATLLLSPTSSAHIAGRRLARFSTGGKTPLAEGLLAARALIIR
EKVRDRARRPLVVVLTDGRATAGPDPLGRSRTAAAGLVAEGAAAVVVDCETSYVRLGLAA
QLARQLGAPVVRLEQLHADYLVHAVRGVA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgaagccttatccgttcagcgcgatcgtcgggcacgatcggctgcggctcgcgttgttg
ttgtgtgccgtgcgaccggagatcggtggggcgctcatccgtggcgagaagggcacggcg
aaatcgacggcggtgcgcgggctggccgcgttgttgtcggtcgcgaccgggagcaccgag
accggcctcgtggagctgccgctgggggccaccgaagaccgggtggttggctcgctggat
ctgcagcgggtgatgcgcgacggcgagcacgcgttctctccgggactgctggctcgcgcc
cacggcggcgtgctctacgtcgacgaggtcaatctgctgcatgatcacctggttgacatc
ctgctcgacgccgccgccatgggacgcgtacacgtcgaacgcgacggcatctcccattcc
cacgaggcccgtttcgtgctgatcggcacgatgaatccggaggagggcgaactgcgtccg
cagctgctggaccggttcgggctgaccgtcgacgtgcaggcgtcacgtgacatcgacgtg
cgggtacaggtcatccgccggcggatggcctacgaagccgacccggatgcgttcgtcgca
cgctatgccgacgccgacgcggagctggcccaccggattgccgcggcccgggccacggta
gacgatgtggtgttgggcgacaacgagttgcggcgcatcgctgcgttgtgcgcggcgttc
gacgtggacggcatgcgggccgatctggtagtggcccggaccgccgccgcgcacgccgcc
tggcgtggtgtccgcaccgttgaggagcaggatatccgggcggcagcagaactggcgttg
ccgcatcgtcgtcgtcgcgacccgttcgacgatcacggcatcgaccgcgaccagctggat
gaggcgctggcgctggcgagcgtcgacccagagcccgagcccgatccgcccgggggcggc
cagtcagccaatgaacctgcctcacaaccgaactcacgctcgaagtcgacagaacctggt
gcgccgagctcgatgggcgacgacccgccgcgcccggcttcgccgcgcttgcgatcgtcg
ccgcgcccgagcgcgccgccgtcaaagatattccggacccgcgcgctgcgggtcccgggg
gtcggcacgggcgcgccggggcgacggtctcgggcccgcaacgcctcgggcagtgtggtg
gcggccgccgaggtcagcgaccccgacgcacatggactgcacctgttcgctaccctgctg
gccgccggcgagcgtgcgttcggagccgggccgttgcgcccgtggccggacgatgtgcgc
cgggccatccgcgagggtcgcgaaggcaatctggtgatcttcgtcgtcgacgcttccgga
tcgatggctgctcgggaccggatggctgcggtcagtggcgccaccctgtcgctgctgcgc
gacgcctaccagcgcagggacaaggtggcggtgatcaccttccgccagcacgaggcaacg
ctgttgctgtcgccgacgtcgtcggcgcacatcgccggccggcgactggcccgattcagc
accggcggcaagaccccgctggctgagggactgctggccgcgcgtgcgctgatcatccgg
gagaaggtacgcgaccgcgcccgacgccccctggtggtcgtgctgaccgacggccgggcc
accgccgggccggacccgttgggccgcagccgaaccgcggctgccgggctggtcgccgag
ggcgcggccgcggtggtggtggactgcgaaacgtcgtatgtacggctgggtttggcagcg
caactggctcgtcagctgggtgcgccggtggttcggttggagcagttgcacgcggattat
ctagtgcatgccgtgcgtggcgtggcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system