KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_21840Help
Entry
MRGA327_21840     CDS       T01775                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MRGA327_21840
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MRGA327_21840
   00650 Butanoate metabolism
    MRGA327_21840
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MRGA327_21840
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRGA327_21840
   00622 Xylene degradation
    MRGA327_21840
   00621 Dioxin degradation
    MRGA327_21840
Enzymes [BR:mtg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MRGA327_21840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3941936..3942850)
Genome map
AA seq 304 aa AA seqDB search
MPSKAKVAIVGSGNISTDLLYKLLRSEWLEPRWMVGIDPESDGLARAAKLGLETTHEGVD
WLLAQPDKPDLVFEATSAYVHRDAAPKYAEAGIRAIDLTPAAVGPAVIPPANLREHLGAP
PSRNMITCGGQATIPIVYAVSRIVEVPYAEIVASVASVSAGPGTRANIDEFTKTTARGVQ
TIGGAARGKAIIILNPADPPMIMRDTIFCAIPTDADREAIAASIHDVVKEVQTYVPGYRL
LNEPQFDEPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLVV
GGAR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaaggcaaaagtggcgattgtcgggtcgggaaatatcagcaccgatctgctg
tacaagctgctgcgatcggagtggctggagccgcgctggatggtgggcatcgacccggag
agcgatggcctggcgcgcgcggccaagctgggtttggagaccacccacgagggggtggac
tggctgctggcgcagcccgataaacccgacctggtgttcgaggcaaccagtgcctacgtg
caccgggacgcggcgcccaagtacgccgaggccgggatccgggccatcgacctgacgccg
gcggcggtgggtccggcggtgatcccgccggcgaacctgcgcgagcacctgggcgcgccg
ccgagccgcaacatgatcacctgcgggggacaggcgaccattccgatcgtgtacgcggtg
tctcggatcgtggaggtgccctacgccgagatcgtggcgtcggtggcttccgtttcagcg
ggaccgggcacgcgcgccaacatcgacgagttcaccaagaccaccgcccgtggggtccag
accatcggcggggccgcccgcggcaaggcgatcatcatcttgaatcccgccgacccgccg
atgatcatgcgcgacaccatcttttgcgccatccccaccgacgccgaccgcgaagcgatc
gccgcctccatccacgacgtcgtcaaagaggtgcagacctacgtgcctggataccggctg
ctcaacgaaccgcagttcgacgagccgtcgatcaactcgggcgggcaggcgctggtcacc
acgttcgtcgaggttgagggcgccggggattacctgccgccctatgcgggcaacctggac
atcatgaccgcggcggccaccaaggtgggcgaggagatcgccaaggagacgctggttgta
ggaggagcgcgatga

DBGET integrated database retrieval system