KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_22235Help
Entry
MRGA327_22235     CDS       T01775                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mtg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4016558..4017124)
Genome map
AA seq 188 aa AA seqDB search
MTRVVLSVGSNLGDRLARLRSVADGLGDALIAASPIYEADPWGGVEQGQFLNAVLIADDP
TCEPREWLRRAQEFERAAGRVRGQRWGPRNLDVDLIACYQTSATEALVEVTARENHLTLP
HPLAHLRAFVLIPWIAVDPTAQLTVAGCPRPVTRLLAELEPADRDSVRLFRPSFDLNSRH
PVSRAPES
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgggtagtgctctcggttggctccaacctgggtgaccgcctggcacgattgcgg
tcggtcgccgacggtctcggcgatgcgttgattgcggcttccccgatatatgaggccgac
ccctggggtggggtggagcaggggcagttcctcaatgcggtgctgatcgccgacgatcct
acctgcgaaccgcgggagtggctgcggcgggcgcaggagttcgagcgcgctgcgggcagg
gtgcgtggccagcgctggggtccacgaaatctcgacgtcgacctgatcgcctgctaccag
acctcggccaccgaggctctggtcgaagtgaccgcgcgggagaaccacctcacgctgccg
cacccactggcgcatctgcgggcctttgtgttgatcccgtggattgccgtcgacccaacg
gcgcagctgacggttgccgggtgcccgcggcccgtcacgcgactgctggccgagctggag
cccgccgaccgcgacagtgtgcggttgtttaggccgtcgttcgatctgaatagcagacac
cccgtcagtcgggcaccggaaagctga

DBGET integrated database retrieval system