KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_22575Help
Entry
MRGA327_22575     CDS       T01775                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MRGA327_22575
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MRGA327_22575
   00620 Pyruvate metabolism
    MRGA327_22575
   00640 Propanoate metabolism
    MRGA327_22575
  Energy metabolism
   00680 Methane metabolism
    MRGA327_22575
Enzymes [BR:mtg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MRGA327_22575
Lipid biosynthesis proteins [BR:mtg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MRGA327_22575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4076207..4078159
Genome map
AA seq 650 aa AA seqDB search
MSPPPKSPRHTRRQRNFAEHANARAELYREAEEDRLAFWAKQANRLSWTTPFTEVLDWSG
APFAKWFVGGELNVAYNCVDRHVEAGHGDRVAIHWEGEPVGDRRTLTYSDLLAEVSKAAN
ALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAKL
LITADGQFRRGKPSPLKAAADEALAAIPDCSVEHVLVVRRTGIEMAWSEGRDLWWHHVVG
SASPAHTPEPFDSEHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTIFDVKPDSDVF
WCTADIGWVTGHTYGVYGPLCNGVTEVLYEGTPDTPDRHRHFQIIEKYGVTIYYTAPTLI
RMFMKWGREIPDSHDLSSLRLLGSVGEPINPEAWRWYRDVIGGGRTPLVDTWWQTETGSA
MISPLPGIAAAKPGSAMTPLPGISAKIVDDHGDPLPPHTEGAQHVTGYLVLDQPWPSMLR
GIWGDPARYWHSYWSKFSDKGYYFAGDGARIDPDGAIWVLGRIDDVMNVSGHRISTAEVE
SALVAHSGVAEAAVVGVTDETTTQAICAFVVLRANYAPHDRTAEELRTEVARVISPIARP
RDVHVVPELPKTRSGKIMRRLLRDVAENRELGDTSTLLDPTVFDAIRAAK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
gtgagtccacccccgaagtctcctcgtcatacccgccgccagcgcaacttcgccgagcac
gcgaacgcccgcgccgagctttaccgcgaggccgaggaagaccggctggctttttgggcc
aagcaggccaaccgactgtcctggacgacgccgttcaccgaggtgttggactggtcgggg
gcgccgttcgccaagtggttcgtgggcggcgagctcaacgtcgcctacaactgtgtggat
cgtcacgtcgaggccggccatggagatcgggtcgccatccactgggaaggcgagccggtc
ggcgaccggcgcacgctgacctattccgatctgcttgccgaggtatccaaagccgcgaac
gcgctcaccgacctcggtctggtggccggtgaccgcgtcgccatctacctgccgttgatc
cctgaggccgtgatcgccatgctggcctgtgcccggctaggcatcatgcatagcgttgtt
ttcggcgggttcaccgctgcggccttgcaggcccggatcgtcgacgcccaagccaagctg
ctgatcaccgcggacgggcagtttcggcgcggcaagccatcgcccctcaaggcggccgct
gacgaggcccttgcagcgatccccgactgctcggtcgagcacgttctggtggtgcggcgc
acgggaattgagatggcctggagcgagggccgcgacctgtggtggcaccatgtcgtcggc
tcagcttcaccggcacacaccccggagcctttcgattccgagcacccgctgttcctgctg
tacacgtcaggcaccaccggcaagcccaaaggcattatgcacaccagcggcggctatctc
actcagtgttgctacacgatgcgcaccattttcgatgtcaagccggacagcgacgtgttc
tggtgcaccgccgacatcggctgggtcaccggccacacctacggcgtctacggcccgctg
tgcaacggagtcaccgaggttctctacgagggcacgccggatacccccgaccgacaccgg
catttccagatcatcgaaaaatacggcgtgacaatctattacaccgcccccaccctcatc
cggatgtttatgaagtggggccgtgagatccccgacagccacgacctgtccagcctgcgg
ctgctggggtcggtcggcgaaccgatcaaccccgaggcttggcgttggtaccgcgatgtc
atcggcggcggacgcaccccgctggtagacacctggtggcagaccgagaccggctccgcg
atgatctccccgctgcccggaatcgctgcggccaaaccgggttcagcgatgacgccgctg
cccgggatctcggccaagatcgtcgacgatcacggtgatccgttgccaccgcacaccgag
ggcgcccagcatgttaccgggtacctcgtcctagaccagccgtggccgtcgatgttgcgc
ggcatctggggcgaccccgcgcggtattggcactcttactggtccaaattttccgacaag
ggctactacttcgccggggacggcgctcgcatagaccccgacggcgcgatctgggtacta
ggccgcatcgacgacgtgatgaacgtgtccgggcaccggatctcgaccgccgaggtggaa
tcggcgctggtcgctcactctggcgtggccgaggcggcggtggtcggggttaccgacgag
accacgacccaggccatctgtgcgttcgtcgtgctacgcgccaactacgccccccatgac
cgcacagccgaagagttgcgcaccgaagtggctcgagtgatctcgcccatcgcacggcca
cgcgacgtccacgtagtgcccgaactacccaagactcgtagcggcaaaatcatgcgtcga
ctgctgcgcgacgtcgcggaaaaccgtgagcttggcgacacgtcgacgctgctcgatccc
accgtattcgacgcgatccgggccgccaagtag

DBGET integrated database retrieval system