KEGG   Methanothermobacter thermautotrophicus: MTH1041Help
Entry
MTH1041           CDS       T00009                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTH1041
   01230 Biosynthesis of amino acids
    MTH1041
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTH1041
   00051 Fructose and mannose metabolism
    MTH1041
   00562 Inositol phosphate metabolism
    MTH1041
Enzymes [BR:mth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MTH1041
Exosome [BR:mth04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MTH1041
  Exosomal proteins of bladder cancer cells
   MTH1041
  Exosomal proteins of melanoma cells
   MTH1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
951977..952666
Genome map
AA seq 229 aa AA seqDB search
MLEDLELKDTPIVILNFKTYLESTGERALELASICGDVADETGVNMAVAPQHMDLHRVSD
AVEIPVLAQHIDAVDAGGHTGSILAECARDAGAAGTLINHSEKRMQLADIEWVISRMKEL
EMMSVVCTNNVMTTAAAAALGPDFVAVEPPELIGSGIPVSRAEPEVITGSVDAVKKVNPE
VSVLCGAGISTGDDMKAAVDLGAEGVLLASGIILADSPRDALLDLVSKV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggatttggagttgaaggacacacccattgtcatactgaattttaaaacatac
ctcgaatcaacaggtgagagagccctcgaacttgcatcaatatgcggggatgtcgcagat
gagaccggtgttaacatggctgtggcaccgcagcacatggacctccaccgggtgagtgat
gctgtagaaataccggtgctggcacagcacattgacgccgttgatgctggtggacacaca
gggagcatccttgcagagtgcgccagggacgcaggtgcagcaggaaccctcataaaccat
tcagaaaagcggatgcaacttgcagacatcgaatgggtgatatcaaggatgaaggaactt
gagatgatgtccgtggtatgcacgaacaacgtcatgaccactgctgctgccgccgccctg
ggaccggacttcgtggcggttgaaccccctgaactcataggatccggaatacctgtgtca
agggccgaacctgaggttataacgggaagtgttgatgctgtgaagaaggtgaaccctgag
gtcagtgtgctctgtggcgccggaatatccacaggagacgacatgaaggctgctgttgac
ctgggggccgagggtgttcttcttgcatcaggcatcatcctggctgacagcccacgggac
gcccttctggatcttgtaagtaaggtttga

DBGET integrated database retrieval system