KEGG   Methanothermobacter thermautotrophicus: MTH1164Help
Entry
MTH1164           CDS       T00009                                 

Definition
methyl coenzyme M reductase I subunit alpha
Orthology
K00399  
methyl-coenzyme M reductase alpha subunit [EC:2.8.4.1]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogenesis, CO2 => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mth01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mth00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1071084..1072736)
Genome map
AA seq 550 aa AA seqDB search
MADKLFINALKKKFEESPEEKKTTFYTLGGWKQSERKTEFVNAGKEVAAKRGIPQYNPDI
GTPLGQRVLMPYQVSTTDTFVEGDDLHFVNNAAMQQMWDDIRRTVIVGLNHAHAVIEKRL
GKEVTPETITHYLETVNHAMPGAAVVQEHMVETHPALVADSYVKVFTGNDEIADEIDPAF
VIDINKQFPEDQAETLKAEVGDGIWQVVRIPTIVSRTCDGATTSRWSAMQIGMSMISAYK
QAAGEAATGDFAYAAKHAEVIHMGTYLPVRRARGENEPGGVPFGYLADICQSSRVNYEDP
VRVSLDVVATGAMLYDQIWLGSYMSGGVGFTQYATAAYTDNILDDFTYFGKEYVEDKYGL
CEAPNTMDTVLDVASEVTFYGLEQYEEYPALLEDQFGGSQRAAVVAAAAGCSTAFATANA
QTGLSGWYLSMYLHKEQHSRLGFYGYDLQDQCGASNVFSIRGDEGLPLELRGPNYPNYAM
NVGHQGEYAGISQAPHAARGDAFVFNPLVKIAFADDNLVFDFTNVRGEFAKGALREFEPA
GERALITPAK
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaaattgttcataaatgctttaaagaaaaaatttgaagaatcccctgaagag
aagaaaaccacattttacacacttggtggctggaaacagtccgagcgaaaaaccgagttt
gtgaacgctggtaaagaagtggcagcaaagaggggcataccccagtacaaccctgacata
ggtactccgctgggtcagagggtactcatgccctaccaggtctcaacaacagacaccttc
gttgaaggtgacgacctccacttcgtaaacaacgctgccatgcagcagatgtgggacgac
ataagaagaaccgttatagttggtttaaaccatgcccacgccgttatagaaaagaggctg
ggtaaggaggtcacaccagagaccataacccactacctggaaacagtgaaccacgcaatg
cccggtgcagctgtcgtccaggaacacatggtggaaacccacccagcactggtggcagac
agctacgtcaaggtcttcacaggtaacgatgaaatcgcagatgaaattgaccctgcattc
gtcatagacatcaacaaacagttcccagaggaccaggcagaaaccctcaaggcagaggtt
ggagacggaatctggcaggtcgtcaggatcccaaccatagtctcaaggacctgtgacggt
gcaacaacctcacgatggtccgccatgcagataggtatgtccatgatctcagcctacaaa
caggcagcaggtgaagccgcaacaggggacttcgcatacgctgcaaaacacgctgaagtt
atacacatgggtacatacctgcctgtgagacgtgcaaggggtgaaaacgaacctggtggt
gtgccattcggttaccttgctgacatctgtcagagctcaagggtcaactacgaggaccct
gtcagggtgtcacttgacgttgtggcaaccggtgcaatgctctacgaccagatctggctt
ggctcatacatgtcaggtggtgtaggattcacccagtacgcaacagcagcctacacagac
aacatcctcgacgacttcacctacttcggtaaggagtacgtggaggacaaatatggactc
tgtgaggcaccaaacaccatggacacagtcctggacgttgcgagtgaggtcacattctac
ggacttgaacagtacgaggaataccctgcactcctcgaagaccagtttggtggatcccag
agggccgcagtcgttgcagctgcagctggatgttccacagccttcgcaacagcaaatgcc
cagacaggtctcagcggatggtacctctcaatgtacctgcacaaggagcagcactccagg
ctcggattctacggttacgacctccaggaccagtgtggtgcatccaacgtcttctcaata
aggggcgacgagggactgccactggagcttcgtggacctaactatccaaactacgccatg
aacgtgggtcaccagggtgaatacgccggtatatcacaggcaccacacgctgcccgtgga
gacgccttcgtgttcaacccactggtgaaaatagcatttgcagacgacaacctcgtcttc
gacttcaccaacgtacgtggcgagttcgccaaaggtgctctgcgagagttcgaaccagcc
ggtgaaagagcactcataacacctgcaaaatag

DBGET integrated database retrieval system