KEGG   Methanothermobacter thermautotrophicus: MTH1476Help
Entry
MTH1476           CDS       T00009                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTH1476
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTH1476
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTH1476
Enzymes [BR:mth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MTH1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1333109..1334398)
Genome map
AA seq 429 aa AA seqDB search
MMNKIVLDENEIPKKWYNINPDLPSPLPEPKNPEGGKNIENLPRVFSRGVLEQEMSMERW
IKIPREVMDVYKMIGRPTPLFRAKGLEEMLDTPARIYYKREDYSPTGSHKLNTAIAQAYY
ARKDGAERLTTETGAGQWGTALSLACSLMDLQCKVYMVRVSFNQKPFRKTIMQLYGGEVV
PSPSNHTEFGRRMLKEDPEHPGSLGIAISEAMEEALQEENVYYSLGSVLNHVLLHQTVIG
LETKKQLEIAGETPDIMIGCVGGGSNFGGAIFPFVKDKLDGKLDCEFIAAEPKSCPTLTA
GEYRYDFGDTAGMTPLLKMYTLGHDFVPPSVHAGGLRYHGMSPQVALLVREGVINARAVP
QHTIFESGVKFAKAEGVVPAPETCHAISVAIDEARKCRETGEEKTIVISFSGHGLLDLKG
YGDYLEGKI
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgatgaataagatcgttcttgatgaaaatgaaataccaaagaagtggtacaacattaac
ccggaccttccctcaccactaccagaaccaaaaaaccctgagggtgggaagaacattgaa
aacctgccaagggtattctcaaggggagtgcttgagcaggagatgtccatggagagatgg
ataaagattcccagggaggtcatggacgtctataagatgattggaaggcccacaccacta
ttcagggcaaagggccttgaggagatgctggacactccggcaaggatatactacaagagg
gaagactattcccccacagggagccataaactgaacaccgccatagcccaggcatactat
gcccggaaggatggtgcagagagattaacaacagagaccggtgcagggcagtggggaaca
gccctctcccttgcctgctcactgatggacctccagtgcaaggtctacatggtcagagta
tccttcaaccagaaacccttcagaaaaaccataatgcagctatacggtggtgaggttgta
ccatccccaagcaatcacacagaatttggtcgcaggatgctcaaggaggaccccgaacat
cccggatccctgggtatagccatatctgaggccatggaggaggctctccaggaagaaaac
gtctactactcccttggaagtgtacttaaccatgtgctccttcaccagaccgtaataggt
cttgagacaaagaaacagcttgaaatcgcaggtgaaacaccagacatcatgatagggtgc
gttggagggggcagcaacttcgggggggccatcttccccttcgtgaaggacaagcttgat
ggtaagctggactgtgaattcattgctgcagagccaaagtcatgcccaacactcacagcc
ggagagtaccgctacgacttcggtgacactgcaggcatgaccccgctcctcaagatgtac
accctcggccacgactttgtacccccatccgtccatgccggtggcctcaggtaccatgga
atgtcaccccaggtcgcactcctcgtgagggagggtgtgatcaatgccagggccgttccc
cagcacaccatattcgagagcggcgtcaagtttgcaaaggcagagggtgttgtgccggcc
ccggaaacatgccatgccataagtgtggcaatcgatgaagcacgcaagtgccgggaaacc
ggtgaagagaagaccatagttatcagtttctcaggccatggcctcctcgaccttaaggga
tacggtgactacctggagggtaaaatctaa

DBGET integrated database retrieval system